Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DLC1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateThere is BioGPS gene expression data showing that DLC1 is expressed in 721_B)

Rabbit DLC1 Polyclonal Antibody | anti-DLC1 antibody

DLC1 antibody - C-terminal region

Gene Names
DLC1; HP; ARHGAP7; STARD12; p122-RhoGAP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DLC1; Polyclonal Antibody; DLC1 antibody - C-terminal region; anti-DLC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
Sequence Length
467
Applicable Applications for anti-DLC1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DLC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DLC1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateThere is BioGPS gene expression data showing that DLC1 is expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-DLC1 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateThere is BioGPS gene expression data showing that DLC1 is expressed in 721_B)
Related Product Information for anti-DLC1 antibody
This is a rabbit polyclonal antibody against DLC1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization.
Product Categories/Family for anti-DLC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
deleted in liver cancer 1, isoform CRA_b
NCBI Official Synonym Full Names
DLC1 Rho GTPase activating protein
NCBI Official Symbol
DLC1
NCBI Official Synonym Symbols
HP; ARHGAP7; STARD12; p122-RhoGAP
NCBI Protein Information
rho GTPase-activating protein 7
UniProt Protein Name
Deleted in lung and esophageal cancer protein 1
Protein Family
UniProt Gene Name
DLEC1
UniProt Synonym Gene Names
DLC1; DLC-1
UniProt Entry Name
DLEC1_HUMAN

NCBI Description

This gene encodes a GTPase-activating protein (GAP) that is a member of the rhoGAP family of proteins which play a role in the regulation of small GTP-binding proteins. GAP family proteins participate in signaling pathways that regulate cell processes involved in cytoskeletal changes. This gene functions as a tumor suppressor gene in a number of common cancers, including prostate, lung, colorectal, and breast cancers. Multiple transcript variants due to alternative promoters and alternative splicing have been found for this gene.[provided by RefSeq, Apr 2010]

Uniprot Description

DLEC1: May act as a tumor suppressor by inhibiting cell proliferation. DLEC1 silencing due to promoter methylation and aberrant transcription are implicated in the development of different cancers, including esophageal (ESCR), renal and lung cancers (LNCR). Defects in DLEC1 are a cause of lung cancer (LNCR). A common malignancy affecting tissues of the lung. The most common form of lung cancer is non-small cell lung cancer (NSCLC) that can be divided into 3 major histologic subtypes: squamous cell carcinoma, adenocarcinoma, and large cell lung cancer. NSCLC is often diagnosed at an advanced stage and has a poor prognosis. DLEC1 silencing due to promoter methylation and aberrant transcription are implicated in the development of lung cancer. Defects in DLEC1 are a cause of esophageal cancer (ESCR). A malignancy of the esophagus. The most common types are esophageal squamous cell carcinoma and adenocarcinoma. Cancer of the esophagus remains a devastating disease because it is usually not detected until it has progressed to an advanced incurable stage. DLEC1 silencing due to promoter methylation and aberrant transcription are implicated in the development of esophageal cancer. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: cytoplasm

Biological Process: negative regulation of cell proliferation

Disease: Lung Cancer; Esophageal Cancer

Research Articles on DLC1

Similar Products

Product Notes

The DLC1 dlec1 (Catalog #AAA3210628) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLC1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DLC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DLC1 dlec1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLAVCLAPSL FHLNTLKREN SSPRVMQRKQ SLGKPDQKDL NENLAATQGL. It is sometimes possible for the material contained within the vial of "DLC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.