Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SEPT6(septin 6) Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that SEPT6(septin 6) is expressed in Jurkat)

Rabbit SEPT6 Polyclonal Antibody | anti-SEPT6 antibody

SEPT6 Antibody - N-terminal region

Gene Names
SEPT6; SEP2; SEPT2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEPT6; Polyclonal Antibody; SEPT6 Antibody - N-terminal region; anti-SEPT6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV
Sequence Length
119
Applicable Applications for anti-SEPT6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT6(septin 6)
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SEPT6(septin 6) Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that SEPT6(septin 6) is expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-SEPT6(septin 6) Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that SEPT6(septin 6) is expressed in Jurkat)
Related Product Information for anti-SEPT6 antibody
This is a rabbit polyclonal antibody against SEPT6(septin 6) . It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SEPT6 is a member of the septin family of GTPases. Members of this family are required for cytokinesis.
Product Categories/Family for anti-SEPT6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12kDa
NCBI Official Full Name
septin 6, isoform CRA_g
NCBI Official Synonym Full Names
septin 6
NCBI Official Symbol
SEPT6
NCBI Official Synonym Symbols
SEP2; SEPT2
NCBI Protein Information
septin-6
UniProt Protein Name
Septin-6
UniProt Gene Name
SEPT6
UniProt Synonym Gene Names
KIAA0128; SEP2
UniProt Entry Name
SEPT6_HUMAN

NCBI Description

This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis. One version of pediatric acute myeloid leukemia is the result of a reciprocal translocation between chromosomes 11 and X, with the breakpoint associated with the genes encoding the mixed-lineage leukemia and septin 2 proteins. This gene encodes four transcript variants encoding three distinct isoforms. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

SEPT6: Filament-forming cytoskeletal GTPase. Required for normal organization of the actin cytoskeleton. Involved in cytokinesis. May play a role in HCV RNA replication. Belongs to the septin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Cytoskeletal

Chromosomal Location of Human Ortholog: Xq24

Cellular Component: synaptic vesicle; spindle; midbody; nerve terminal; cleavage furrow

Molecular Function: protein binding; GTP binding

Biological Process: viral reproduction; cytokinesis

Research Articles on SEPT6

Similar Products

Product Notes

The SEPT6 sept6 (Catalog #AAA3208115) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEPT6 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SEPT6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SEPT6 sept6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGLGKSTLMD TLFNTKFEGE PATHTQPGVQ LQSNTYDLQE SNVRLKLTIV. It is sometimes possible for the material contained within the vial of "SEPT6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.