Western Blot (WB)
(WB Suggested Anti-RASGEF1C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Rabbit RASGEF1C Polyclonal Antibody | anti-RASGEF1C antibody
RASGEF1C antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RASGEF1C; Polyclonal Antibody; RASGEF1C antibody - middle region; anti-RASGEF1C antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSEDGLYLASYESE
Sequence Length
466
Applicable Applications for anti-RASGEF1C antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RASGEF1C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RASGEF1C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Western Blot (WB)
(WB Suggested Anti-RASGEF1C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human heart)
Related Product Information for anti-RASGEF1C antibody
This is a rabbit polyclonal antibody against RASGEF1C. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RASGEF1C is the guanine nucleotide exchange factor (GEF).
Target Description: RASGEF1C is the guanine nucleotide exchange factor (GEF).
Product Categories/Family for anti-RASGEF1C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
ras-GEF domain-containing family member 1C
NCBI Official Synonym Full Names
RasGEF domain family member 1C
NCBI Official Symbol
RASGEF1C
NCBI Protein Information
ras-GEF domain-containing family member 1C
UniProt Protein Name
Ras-GEF domain-containing family member 1C
Protein Family
UniProt Gene Name
RASGEF1C
UniProt Entry Name
RGF1C_HUMAN
Similar Products
Product Notes
The RASGEF1C rasgef1c (Catalog #AAA3212372) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RASGEF1C antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RASGEF1C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RASGEF1C rasgef1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLELAKQVGE FITWKQVECP FEQDASITHY LYTAPIFSED GLYLASYESE. It is sometimes possible for the material contained within the vial of "RASGEF1C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
