Western Blot (WB)
(Western blot-STARD3NL Polyclonal Antibody)
Rabbit STARD3NL Polyclonal Antibody | anti-STARD3NL antibody
STARD3NL Polyclonal Antibody
Gene Names
STARD3NL; MENTHO
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
STARD3NL; Polyclonal Antibody; STARD3NL Polyclonal Antibody; MENTHO; STARD3 N-terminal like; anti-STARD3NL antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.03 mg/ml (varies by lot)
Sequence Length
234
Applicable Applications for anti-STARD3NL antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 185-234 of human STARD3NL (NP_114405.1).
Immunogen Sequence
RLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL
Positive Samples
Jurkat, Mouse Spleen, Rat Spleen
Cellular Location
Late Endosome Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-STARD3NL Polyclonal Antibody)
Western Blot (WB)
(Western blot-STARD3NL Polyclonal Antibody)
Related Product Information for anti-STARD3NL antibody
This gene encodes a late-endosomal protein that contains a conserved MENTAL (MLN64 N-terminal) domain. The encoded protein binds cholesterol molecules and may play a role in endosomal cholesterol transport through interactions with metastatic lymph node protein 64 (MLN64).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 25kDa; 26kDa
Observed: 30kDa
Observed: 30kDa
NCBI Official Full Name
STARD3 N-terminal-like protein isoform 1
NCBI Official Synonym Full Names
STARD3 N-terminal like
NCBI Official Symbol
STARD3NL
NCBI Official Synonym Symbols
MENTHO
NCBI Protein Information
STARD3 N-terminal-like protein
UniProt Protein Name
MLN64 N-terminal domain homolog
Protein Family
UniProt Gene Name
STARD3NL
UniProt Synonym Gene Names
MENTHO
UniProt Entry Name
MENTO_HUMAN
NCBI Description
This gene encodes a late-endosomal protein that contains a conserved MENTAL (MLN64 N-terminal) domain. The encoded protein binds cholesterol molecules and may play a role in endosomal cholesterol transport through interactions with metastatic lymph node protein 64 (MLN64). [provided by RefSeq, Sep 2011]
Research Articles on STARD3NL
Similar Products
Product Notes
The STARD3NL stard3nl (Catalog #AAA9140927) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STARD3NL Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STARD3NL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the STARD3NL stard3nl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STARD3NL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
