Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-ABCA2 Polyclonal Antibody)

Rabbit anti-Mouse ABCA2 Polyclonal Antibody | anti-ABCA2 antibody

ABCA2 Polyclonal Antibody

Gene Names
ABCA2; ABC2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ABCA2; Polyclonal Antibody; ABCA2 Polyclonal Antibody; ABC2; ATP binding cassette subfamily A member 2; anti-ABCA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.15 mg/ml (varies by lot)
Sequence Length
2466
Applicable Applications for anti-ABCA2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:1000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 2307-2466 of human ABCA2 (NP_997698.1).
Immunogen Sequence
FGDGYMITVRTKSSQSVKDVVRFFNRNFPEAMLKERHHTKVQYQLKSEHISLAQVFSKMEQVSGVLGIEDYSVSQTTLDNVFVNFAKKQSDNLEQQETEPPSALQSPLGCLLSLLRPRSAPTELRALVADEPEDLDTEDEGLISFEEERAQLSFNTDTLC
Positive Samples
Mouse Brain
Cellular Location
Endosome Membrane, Lysosome Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-ABCA2 Polyclonal Antibody)

Western Blot (WB) (Western blot-ABCA2 Polyclonal Antibody)
Related Product Information for anti-ABCA2 antibody
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is highly expressed in brain tissue and may play a role in macrophage lipid metabolism and neural development. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
20
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 230kDa; 269kDa
Observed: 270kDa
NCBI Official Full Name
ATP-binding cassette sub-family A member 2 isoform b
NCBI Official Synonym Full Names
ATP binding cassette subfamily A member 2
NCBI Official Symbol
ABCA2
NCBI Official Synonym Symbols
ABC2
NCBI Protein Information
ATP-binding cassette sub-family A member 2
UniProt Protein Name
ATP-binding cassette sub-family A member 2
Protein Family
UniProt Gene Name
ABCA2
UniProt Synonym Gene Names
ABC2; KIAA1062; ATP-binding cassette 2

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This protein is highly expressed in brain tissue and may play a role in macrophage lipid metabolism and neural development. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Probable transporter, its natural substrate has not been found yet. May have a role in macrophage lipid metabolism and neural development.

Research Articles on ABCA2

Similar Products

Product Notes

The ABCA2 abca2 (Catalog #AAA9140980) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABCA2 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ABCA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:1000. Researchers should empirically determine the suitability of the ABCA2 abca2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABCA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.