Western Blot (WB)
(Western blot-ZNRF1 Polyclonal Antibody)
Rabbit ZNRF1 Polyclonal Antibody | anti-ZNRF1 antibody
ZNRF1 Polyclonal Antibody
Gene Names
ZNRF1; NIN283
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ZNRF1; Polyclonal Antibody; ZNRF1 Polyclonal Antibody; NIN283; zinc and ring finger 1; anti-ZNRF1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.21 mg/ml (varies by lot)
Sequence Length
227
Applicable Applications for anti-ZNRF1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human ZNRF1 (NP_115644.1).
Immunogen Sequence
MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRL
Positive Samples
SH-SY5Y, Jurkat, Mouse Thymus, Mouse Lung, Rat Thymus
Cellular Location
Cytoplasmic Vesicle, Endosome, Lysosome, Membrane, Peripheral Membrane Protein, Secretory Vesicle, Synaptic Vesicle Membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot-ZNRF1 Polyclonal Antibody)
Western Blot (WB)
(Western blot-ZNRF1 Polyclonal Antibody)
Related Product Information for anti-ZNRF1 antibody
This gene encodes an E3 ubiquitin-protein ligase that plays a role in neural-cell differentiation. Overexpression of this gene causes neurite-like elongation. The encoded protein contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification, and in synaptic vessicle membranes in neurons.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 23kDa; 29kDa
Observed: 24kDa
Observed: 24kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase ZNRF1
NCBI Official Synonym Full Names
zinc and ring finger 1
NCBI Official Symbol
ZNRF1
NCBI Official Synonym Symbols
NIN283
NCBI Protein Information
E3 ubiquitin-protein ligase ZNRF1
UniProt Protein Name
E3 ubiquitin-protein ligase ZNRF1
Protein Family
UniProt Gene Name
ZNRF1
UniProt Synonym Gene Names
NIN283
UniProt Entry Name
ZNRF1_HUMAN
NCBI Description
This gene encodes an E3 ubiquitin-protein ligase that plays a role in neural-cell differentiation. Overexpression of this gene causes neurite-like elongation. The encoded protein contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification, and in synaptic vessicle membranes in neurons. [provided by RefSeq, Feb 2012]
Research Articles on ZNRF1
Similar Products
Product Notes
The ZNRF1 znrf1 (Catalog #AAA9140612) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNRF1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNRF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ZNRF1 znrf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZNRF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
