Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SIRPB1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SIRPB1 Polyclonal Antibody | anti-SIRPB1 antibody

SIRPB1 Antibody - middle region

Gene Names
SIRPG; CD172g; SIRPB2; SIRP-B2; bA77C3.1; SIRPgamma
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SIRPB1; Polyclonal Antibody; SIRPB1 Antibody - middle region; anti-SIRPB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TCESHGFSPRDITLKWFKNGNELSDFQTNVDPAGDSVSYSIHSTARVVLT
Sequence Length
354
Applicable Applications for anti-SIRPB1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SIRPB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SIRPB1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SIRPB1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SIRPB1 antibody
The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein was found to interact with TYROBP/DAP12, a protein bearing immunoreceptor tyrosine-based activation motifs. This protein was also reported to participate in the recruitment of tyrosine kinase SYK. Multiple transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
signal-regulatory protein gamma isoform 3
NCBI Official Synonym Full Names
signal regulatory protein gamma
NCBI Official Symbol
SIRPG
NCBI Official Synonym Symbols
CD172g; SIRPB2; SIRP-B2; bA77C3.1; SIRPgamma
NCBI Protein Information
signal-regulatory protein gamma
UniProt Protein Name
Signal-regulatory protein gamma
Protein Family
UniProt Gene Name
SIRPG
UniProt Synonym Gene Names
SIRPB2; SIRP-gamma; SIRP-b2; SIRP-beta-2
UniProt Entry Name
SIRPG_HUMAN

NCBI Description

The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

SIRPG: Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T- cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell activation. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: protein binding

Biological Process: negative regulation of cell proliferation; cell-cell signaling; positive regulation of cell proliferation; positive regulation of cell-cell adhesion; positive regulation of T cell activation; cell adhesion; blood coagulation; leukocyte migration

Research Articles on SIRPB1

Similar Products

Product Notes

The SIRPB1 sirpg (Catalog #AAA3222671) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIRPB1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SIRPB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SIRPB1 sirpg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TCESHGFSPR DITLKWFKNG NELSDFQTNV DPAGDSVSYS IHSTARVVLT. It is sometimes possible for the material contained within the vial of "SIRPB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.