Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of C18orf22 expression in transfected 293T cell line by C18orf22 polyclonal antibody. Lane 1: C18orf22 transfected lysate (37.84kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human RBFA Polyclonal Antibody | anti-rbfA antibody

RBFA (Putative Ribosome-binding Factor A, Mitochondrial, C18orf22, FLJ21172)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RBFA; Polyclonal Antibody; RBFA (Putative Ribosome-binding Factor A; Mitochondrial; C18orf22; FLJ21172); Anti -RBFA (Putative Ribosome-binding Factor A; anti-rbfA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C18orf22.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MWAAAGGLWRSRAGLRALFRSRDAALFPGCERGLHCSAVSCKNWLKKFASKTKKKVWYESPSLGSHSTYKPSKLEFLMRSTSKKTRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADFGPRDERDNFVQNDFRDPDAPQPCGTTEPTTSSSLCGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMQKGRKRAKPRLEQDSSLKSYLSGEEVEDDLDLVGAPEYECYAPDTEELEAERGGGRTEDGHSCGASRE
Applicable Applications for anti-rbfA antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human C18orf22, aa1-344 (AAH14195).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of C18orf22 expression in transfected 293T cell line by C18orf22 polyclonal antibody. Lane 1: C18orf22 transfected lysate (37.84kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C18orf22 expression in transfected 293T cell line by C18orf22 polyclonal antibody. Lane 1: C18orf22 transfected lysate (37.84kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-rbfA antibody
Belongs to the rbfA family.
Product Categories/Family for anti-rbfA antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
18,200 Da
NCBI Official Full Name
rbfA
UniProt Protein Name
Ribosome-binding factor A
Protein Family
UniProt Gene Name
rbfA
UniProt Entry Name
RBFA_CLAM3

Uniprot Description

Function: Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Essential for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA

By similarity. HAMAP-Rule MF_00003

Subcellular location: Cytoplasm

Potential HAMAP-Rule MF_00003.

Sequence similarities: Belongs to the RbfA family.

Similar Products

Product Notes

The RBFA rbfa (Catalog #AAA6010458) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBFA (Putative Ribosome-binding Factor A, Mitochondrial, C18orf22, FLJ21172) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBFA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the RBFA rbfa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWAAAGGLWR SRAGLRALFR SRDAALFPGC ERGLHCSAVS CKNWLKKFAS KTKKKVWYES PSLGSHSTYK PSKLEFLMRS TSKKTRKEDH ARLRALNGLL YKALTDLLCT PEVSQELYDL NVELSKVSLT PDFSACRAYW KTTLSAEQNA HMEAVLQRSA AHMRHLLMSQ QTLRNVPPIV FVQDKGNAAL AELDQLLAVA DFGPRDERDN FVQNDFRDPD APQPCGTTEP TTSSSLCGID HEALNKQIME YKRRKDKGLG GLVWQGQVAE LTTQMQKGRK RAKPRLEQDS SLKSYLSGEE VEDDLDLVGA PEYECYAPDT EELEAERGGG RTEDGHSCGA SRE. It is sometimes possible for the material contained within the vial of "RBFA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.