Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of C8orf33 expression in transfected 293T cell line by C8orf33 polyclonal antibody. Lane 1: C8orf33 transfected lysate (25.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human C8orf33 Polyclonal Antibody | anti-C8orf33 antibody

C8orf33 (UPF0488 Protein C8orf33, FLJ20989)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
C8orf33; Polyclonal Antibody; C8orf33 (UPF0488 Protein C8orf33; FLJ20989); Anti -C8orf33 (UPF0488 Protein C8orf33; anti-C8orf33 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C8orf33.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF
Applicable Applications for anti-C8orf33 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human C8orf33, aa1-229 (AAH10001.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of C8orf33 expression in transfected 293T cell line by C8orf33 polyclonal antibody. Lane 1: C8orf33 transfected lysate (25.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of C8orf33 expression in transfected 293T cell line by C8orf33 polyclonal antibody. Lane 1: C8orf33 transfected lysate (25.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-C8orf33 antibody
C8orf33 belongs to the UPF0488 family. There are two named isoforms.
Product Categories/Family for anti-C8orf33 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
24,993 Da
NCBI Official Full Name
C8orf33 protein, partial
NCBI Official Synonym Full Names
chromosome 8 open reading frame 33
NCBI Official Symbol
C8orf33
NCBI Protein Information
UPF0488 protein C8orf33
UniProt Protein Name
UPF0488 protein C8orf33
Protein Family
UniProt Gene Name
C8orf33
UniProt Entry Name
CH033_HUMAN

Uniprot Description

C8orf33: Belongs to the UPF0488 family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 8q24.3

Similar Products

Product Notes

The C8orf33 c8orf33 (Catalog #AAA642447) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C8orf33 (UPF0488 Protein C8orf33, FLJ20989) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C8orf33 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the C8orf33 c8orf33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAALGHLAGE AAAAPGPGTP CASRGARLPG PVSSARNPST VCLCPEQPTC SNADSRAHPL GDEGGTASKK QKNKKKTRNR ASVANGGEKA SEKLAPEEVP LSAEAQAQQL AQELAWCVEQ LELGLKRQKP TPKQKEQAIG AIRTLRSKRT PLPRKRQLMH SLFGDYRAQM EAEWREALRA LRAAAYSAQV QPVDGATRKK SQRVCRPRSI WRAKATLDMP DEEFRFNFF. It is sometimes possible for the material contained within the vial of "C8orf33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.