Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: SLC4A2Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Rabbit SLC4A2 Polyclonal Antibody | anti-SLC4A2 antibody

SLC4A2 antibody - N-terminal region

Gene Names
SLC4A2; AE2; HKB3; BND3L; NBND3; EPB3L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC4A2; Polyclonal Antibody; SLC4A2 antibody - N-terminal region; anti-SLC4A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSSAPRRPAKGADSFCTPEPESLGPGTPGFPEQEEDELHRTLGVERFEEI
Sequence Length
1241
Applicable Applications for anti-SLC4A2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 92%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC4A2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: SLC4A2Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: SLC4A2Sample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-SLC4A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysateSLC4A2 is supported by BioGPS gene expression data to be expressed in ACHN)

Western Blot (WB) (WB Suggested Anti-SLC4A2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: ACHN cell lysateSLC4A2 is supported by BioGPS gene expression data to be expressed in ACHN)
Related Product Information for anti-SLC4A2 antibody
This is a rabbit polyclonal antibody against SLC4A2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SLC4A2 is a plasma membrane anion exchange protein of wide distribution.
Product Categories/Family for anti-SLC4A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
137kDa
NCBI Official Full Name
anion exchange protein 2 isoform 1
NCBI Official Synonym Full Names
solute carrier family 4 member 2
NCBI Official Symbol
SLC4A2
NCBI Official Synonym Symbols
AE2; HKB3; BND3L; NBND3; EPB3L1
NCBI Protein Information
anion exchange protein 2
UniProt Protein Name
Anion exchange protein 2
Protein Family
UniProt Gene Name
SLC4A2
UniProt Synonym Gene Names
AE2; EPB3L1; HKB3; MPB3L; AE 2; Anion exchanger 2; BND3L
UniProt Entry Name
B3A2_HUMAN

NCBI Description

This gene encodes a member of the anion exchanger family of membrane transport proteins. The encoded protein regulates intracellular pH, biliary bicarbonate secretion, and chloride uptake. Reduced expression of this gene may be associated with primary biliary cirrhosis (PBC) in human patients, while differential expression of this gene may be associated with malignant hepatocellular carcinoma, colon and gastric cancers. [provided by RefSeq, Nov 2016]

Uniprot Description

SLC4A2: Plasma membrane anion exchange protein of wide distribution. Belongs to the anion exchanger (TC 2.A.31) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Transporter, SLC family; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7q36.1

Cellular Component: focal adhesion; membrane; basolateral plasma membrane; integral to plasma membrane; plasma membrane

Molecular Function: chloride transmembrane transporter activity; inorganic anion exchanger activity; anion transmembrane transporter activity

Biological Process: bicarbonate transport; regulation of intracellular pH; ion transport; transmembrane transport; anion transport

Research Articles on SLC4A2

Similar Products

Product Notes

The SLC4A2 slc4a2 (Catalog #AAA3207052) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC4A2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's SLC4A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC4A2 slc4a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSSAPRRPAK GADSFCTPEP ESLGPGTPGF PEQEEDELHR TLGVERFEEI. It is sometimes possible for the material contained within the vial of "SLC4A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.