Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TRIM44 expression in transfected 293T cell line by TRIM44 polyclonal antibody. Lane 1: TRIM44 transfected lysate (37.84kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human TRIM44 Polyclonal Antibody | anti-TRIM44 antibody

TRIM44 (Tripartite Motif-containing Protein 44, Protein DIPB, DIPB)

Gene Names
TRIM44; MC7; DIPB; HSA249128
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TRIM44; Polyclonal Antibody; TRIM44 (Tripartite Motif-containing Protein 44; Protein DIPB; DIPB); Anti -TRIM44 (Tripartite Motif-containing Protein 44; anti-TRIM44 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TRIM44.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Applicable Applications for anti-TRIM44 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human TRIM44, aa1-344 (NP_060053).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TRIM44 expression in transfected 293T cell line by TRIM44 polyclonal antibody. Lane 1: TRIM44 transfected lysate (37.84kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TRIM44 expression in transfected 293T cell line by TRIM44 polyclonal antibody. Lane 1: TRIM44 transfected lysate (37.84kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TRIM44 antibody
May play a role in the process of differentiation and maturation of neuronal cells (By similarity). May regulate the activity of TRIM17.
Product Categories/Family for anti-TRIM44 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,472 Da
NCBI Official Full Name
tripartite motif-containing protein 44
NCBI Official Synonym Full Names
tripartite motif containing 44
NCBI Official Symbol
TRIM44
NCBI Official Synonym Symbols
MC7; DIPB; HSA249128
NCBI Protein Information
tripartite motif-containing protein 44; tripartite motif-containing 44
UniProt Protein Name
Tripartite motif-containing protein 44
UniProt Gene Name
TRIM44
UniProt Synonym Gene Names
DIPB
UniProt Entry Name
TRI44_HUMAN

NCBI Description

This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May play a role in the process of differentiation and maturation of neuronal cells

By similarity. May regulate the activity of TRIM17. Ref.6

Subunit structure: Interacts (via coiled coil) with TRIM17 (via coiled coil). Ref.6

Tissue specificity: Highly expressed in testis. Ref.6

Sequence similarities: Contains 1 B box-type zinc finger.

Research Articles on TRIM44

Similar Products

Product Notes

The TRIM44 trim44 (Catalog #AAA645988) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TRIM44 (Tripartite Motif-containing Protein 44, Protein DIPB, DIPB) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIM44 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the TRIM44 trim44 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASGVGAAFE ELPHDGTCDE CEPDEAPGAE EVCRECGFCY CRRHAEAHRQ KFLSHHLAEY VHGSQAWTPP ADGEGAGKEE AEVKVEQERE IESEAGEESE SEEESESEEE SETEEESEDE SDEESEEDSE EEMEDEQESE AEEDNQEEGE SEAEGETEAE SEFDPEIEME AERVAKRKCP DHGLDLSTYC QEDRQLICVL CPVIGAHQGH QLSTLDEAFE ELRSKDSGGL KAAMIELVER LKFKSSDPKV TRDQMKMFIQ QEFKKVQKVI ADEEQKALHL VDIQEAMATA HVTEILADIQ SHMDRLMTQM AQAKEQLDTS NESAEPKAEG DEEGPSGASE EEDT. It is sometimes possible for the material contained within the vial of "TRIM44, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.