Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PSG9 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit anti-Human PSG9 Polyclonal Antibody | anti-PSG9 antibody

PSG9 antibody - N-terminal region

Gene Names
PSG9; PS34; PSG11; PSGII; PSBG-9; PSBG-11
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PSG9; Polyclonal Antibody; PSG9 antibody - N-terminal region; anti-PSG9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI
Sequence Length
495
Applicable Applications for anti-PSG9 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PSG9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PSG9 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PSG9 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-PSG9 antibody
This is a rabbit polyclonal antibody against PSG9. It was validated on Western Blot

Target Description: The function remains unknown.
Product Categories/Family for anti-PSG9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
pregnancy specific beta-1-glycoprotein 9, isoform CRA_f
NCBI Official Synonym Full Names
pregnancy specific beta-1-glycoprotein 9
NCBI Official Symbol
PSG9
NCBI Official Synonym Symbols
PS34; PSG11; PSGII; PSBG-9; PSBG-11
NCBI Protein Information
pregnancy-specific beta-1-glycoprotein 9
UniProt Protein Name
Pregnancy-specific beta-1-glycoprotein 9
UniProt Gene Name
PSG9
UniProt Synonym Gene Names
PSG11; PS-beta-G-9; PSBG-9; Pregnancy-specific glycoprotein 9; PS-beta-B; PS-beta-G-11; PSBG-11; Pregnancy-specific glycoprotein 11; PSG7

NCBI Description

The protein encoded by this gene is a member of the pregnancy-specific glycoprotein (PSG) family. This protein family and the closely related carcinoembryonic antigen cell adhesion molecule (CEACAM) gene family are both members of the immunoglobulin superfamily, and are organized as a large gene cluster. This protein is thought to inhibit platelet-fibrinogen interactions. Several studies suggest that reduced serum concentrations of PSGs are associated with fetal growth restrictions, while up-regulation of this gene has been observed in colorectal cancers. Several pseudogenes of this gene are found on chromosome 19. Alternative splicing results in multiple transcript variants that encode multiple protein isoforms. [provided by RefSeq, Sep 2014]

Uniprot Description

PSG9: Belongs to the immunoglobulin superfamily. CEA family

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.31

Cellular Component: extracellular region

Biological Process: female pregnancy

Research Articles on PSG9

Similar Products

Product Notes

The PSG9 psg9 (Catalog #AAA3206181) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSG9 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSG9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PSG9 psg9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSNASLLIQN VTRKDAGTYT LHIIKRGDET REEIRHFTFT LYLETPKPYI. It is sometimes possible for the material contained within the vial of "PSG9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.