Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit anti-Human PSG3 Polyclonal Antibody | anti-PSG3 antibody

PSG3 antibody - N-terminal region

Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
PSG3; Polyclonal Antibody; PSG3 antibody - N-terminal region; anti-PSG3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS
Sequence Length
143
Applicable Applications for anti-PSG3 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PSG3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(WB Suggested Anti-PSG3 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PSG3 Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-PSG3 antibody
This is a rabbit polyclonal antibody against PSG3. It was validated on Western Blot and immunohistochemistry

Target Description: The function remains unknown.
Product Categories/Family for anti-PSG3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
pregnancy-specific beta-1-glycoprotein 3, partial
NCBI Official Synonym Full Names
pregnancy specific beta-1-glycoprotein 3
NCBI Official Symbol
PSG3
NCBI Protein Information
pregnancy-specific beta-1-glycoprotein 3
UniProt Protein Name
Pregnancy-specific beta-1-glycoprotein 3
UniProt Gene Name
PSG3
UniProt Synonym Gene Names
PS-beta-G-3; PSBG-3
UniProt Entry Name
PSG3_HUMAN

NCBI Description

The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes. Members of the CEA family consist of a single N domain, with structural similarity to the immunoglobulin variable domains, followed by a variable number of immunoglobulin constant-like A and/or B domains. Most PSGs have an arg-gly-asp (RGD) motif, which has been shown to function as an adhesion recognition signal for several integrins, in the N-terminal domain (summary by Teglund et al., 1994 [PubMed 7851896]). For additional general information about the PSG gene family, see PSG1 (MIM 176390).[supplied by OMIM, Oct 2009]

Uniprot Description

PSG3: Belongs to the immunoglobulin superfamily. CEA family

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: extracellular region

Biological Process: defense response; female pregnancy

Similar Products

Product Notes

The PSG3 psg3 (Catalog #AAA3206451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSG3 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSG3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PSG3 psg3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VYSNASLLIQ NVTREDAGSY TLHIVKRGDG TRGETGHFTF TLYLETPKPS. It is sometimes possible for the material contained within the vial of "PSG3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.