Western Blot (WB)
(WB Suggested Anti-CEACAM7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Rabbit anti-Human CEACAM7 Polyclonal Antibody | anti-CEACAM7 antibody
CEACAM7 antibody - N-terminal region
Gene Names
CEACAM7; CGM2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CEACAM7; Polyclonal Antibody; CEACAM7 antibody - N-terminal region; anti-CEACAM7 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLI
Sequence Length
265
Applicable Applications for anti-CEACAM7 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CEACAM7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CEACAM7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-CEACAM7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-CEACAM7 antibody
This is a rabbit polyclonal antibody against CEACAM7. It was validated on Western Blot
Target Description: The function of CEACAM7 remains unknown.
Target Description: The function of CEACAM7 remains unknown.
Product Categories/Family for anti-CEACAM7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
carcinoembryonic antigen-related cell adhesion molecule 7 preproprotein
NCBI Official Synonym Full Names
carcinoembryonic antigen related cell adhesion molecule 7
NCBI Official Symbol
CEACAM7
NCBI Official Synonym Symbols
CGM2
NCBI Protein Information
carcinoembryonic antigen-related cell adhesion molecule 7
UniProt Protein Name
Carcinoembryonic antigen-related cell adhesion molecule 7
Protein Family
UniProt Gene Name
CEACAM7
UniProt Synonym Gene Names
CGM2
UniProt Entry Name
CEAM7_HUMAN
NCBI Description
This gene encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Additionally, lower expression levels of this gene may be predictive of rectal cancer recurrence. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]
Uniprot Description
CEACAM7: Belongs to the immunoglobulin superfamily. CEA family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, GPI anchor; Immunoglobulin superfamily; Membrane protein, integral
Chromosomal Location of Human Ortholog: 19q13.2
Cellular Component: plasma membrane; integral to membrane
Research Articles on CEACAM7
Similar Products
Product Notes
The CEACAM7 ceacam7 (Catalog #AAA3214664) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEACAM7 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEACAM7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEACAM7 ceacam7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLYGYNWYKG ERVHANYRII GYVKNISQEN APGPAHNGRE TIYPNGTLLI. It is sometimes possible for the material contained within the vial of "CEACAM7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
