Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chromatin Immunoprecipitation (ChIP) (Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)

Rabbit anti-Human, Rat PRMT2 Polyclonal Antibody | anti-PRMT2 antibody

PRMT2 antibody - N-terminal region

Gene Names
PRMT2; HRMT1L1
Reactivity
Human, Rat
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
PRMT2; Polyclonal Antibody; PRMT2 antibody - N-terminal region; anti-PRMT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP
Sequence Length
433
Applicable Applications for anti-PRMT2 antibody
Chromatin IP (ChIP), Western Blot (WB)
Homology
Human: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PRMT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Chromatin Immunoprecipitation (ChIP)

(Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)

Chromatin Immunoprecipitation (ChIP) (Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)

Western Blot (WB)

(WB Suggested Anti-PRMT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysatePRMT2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-PRMT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysatePRMT2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-PRMT2 antibody
This is a rabbit polyclonal antibody against PRMT2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
protein arginine N-methyltransferase 2 isoform 1
NCBI Official Synonym Full Names
protein arginine methyltransferase 2
NCBI Official Symbol
PRMT2
NCBI Official Synonym Symbols
HRMT1L1
NCBI Protein Information
protein arginine N-methyltransferase 2
UniProt Protein Name
Protein arginine N-methyltransferase 2
UniProt Gene Name
PRMT2
UniProt Synonym Gene Names
HMT1; HRMT1L1
UniProt Entry Name
ANM2_HUMAN

Research Articles on PRMT2

Similar Products

Product Notes

The PRMT2 prmt2 (Catalog #AAA3205062) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRMT2 antibody - N-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRMT2 can be used in a range of immunoassay formats including, but not limited to, Chromatin IP (ChIP), Western Blot (WB). Researchers should empirically determine the suitability of the PRMT2 prmt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERAGCCGYIP ANHVGKHVDE YDPEDTWQDE EYFGSYGTLK LHLEMLADQP. It is sometimes possible for the material contained within the vial of "PRMT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.