Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-POP5 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Rabbit POP5 Polyclonal Antibody | anti-POP5 antibody

POP5 antibody - middle region

Gene Names
POP5; RPP2; RPP20; hPop5; HSPC004
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POP5; Polyclonal Antibody; POP5 antibody - middle region; anti-POP5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR
Sequence Length
163
Applicable Applications for anti-POP5 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human POP5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-POP5 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-POP5 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293T)
Related Product Information for anti-POP5 antibody
This is a rabbit polyclonal antibody against POP5. It was validated on Western Blot

Target Description: POP5 is a component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.POP5 is also a component of RNase MRP.
Product Categories/Family for anti-POP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
ribonuclease P/MRP protein subunit POP5 isoform a
NCBI Official Synonym Full Names
POP5 homolog, ribonuclease P/MRP subunit
NCBI Official Symbol
POP5
NCBI Official Synonym Symbols
RPP2; RPP20; hPop5; HSPC004
NCBI Protein Information
ribonuclease P/MRP protein subunit POP5
UniProt Protein Name
Ribonuclease P/MRP protein subunit POP5
UniProt Gene Name
POP5
UniProt Synonym Gene Names
AD-008; HSPC004; x0003; hPop5
UniProt Entry Name
POP5_HUMAN

Research Articles on POP5

Similar Products

Product Notes

The POP5 pop5 (Catalog #AAA3212989) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POP5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POP5 pop5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEFYQLVWSA LPFITYLENK GHRYPCFFNT LHVGGTIRTC QKFLIQYNRR. It is sometimes possible for the material contained within the vial of "POP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.