Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NR4A1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit NR4A1 Polyclonal Antibody | anti-NR4A1 antibody

NR4A1 antibody - C-terminal region

Gene Names
NR4A1; HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NR4A1; Polyclonal Antibody; NR4A1 antibody - C-terminal region; anti-NR4A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHF
Sequence Length
598
Applicable Applications for anti-NR4A1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NR4A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NR4A1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-NR4A1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-NR4A1 antibody
This is a rabbit polyclonal antibody against NR4A1. It was validated on Western Blot

Target Description: NR4A1 encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis.
Product Categories/Family for anti-NR4A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
nuclear receptor subfamily 4 group A member 1 isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 4 group A member 1
NCBI Official Symbol
NR4A1
NCBI Official Synonym Symbols
HMR; N10; TR3; NP10; GFRP1; NAK-1; NGFIB; NUR77
NCBI Protein Information
nuclear receptor subfamily 4 group A member 1
UniProt Protein Name
Nuclear receptor subfamily 4 group A member 1
UniProt Gene Name
NR4A1
UniProt Synonym Gene Names
GFRP1; HMR; NAK1; Nur77
UniProt Entry Name
NR4A1_HUMAN

NCBI Description

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

Nur77: an orphan nuclear receptor and immediate-early gene that regulates cellular proliferation, apoptosis, inflammation, and glucose metabolism. Induced by exercise in muscle and is a functional regulator of glucose metabolism in skeletal muscle. Its level decreases in the muscle of obese insulin-resistant men. Acts concomitantly with NURR1 in regulating the expression of delayed-early genes during liver regeneration. Binds the NGFI-B response element (NBRE) 5'-AAAAGGTCA-3'. May inhibit NF-kappa-B transactivation of IL2. A mediator of TCR-directed thymocyte apoptosis. TCR-signaling induces a FAIM/Akt/Nur77 signaling pathway that is critical for modulating apoptosis in developing thymocytes. A physiological substrate of the MEK-ERK-RSK cascade that modulates nuclear export and intracellular translocation during T cell death. Binds DNA as a monomer. Interacts with GADD45GIP1. Overexpression of Nur77 induces the expression of both p300 and HDAC1. Acetylation by p300 and HDAC1 may regulate the rapid turnover of Nur77 protein.

Protein type: DNA-binding; Apoptosis; Nuclear receptor

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: nucleoplasm; nuclear membrane; cytoplasm; nucleus

Molecular Function: protein binding; ligand-dependent nuclear receptor activity; DNA binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity

Biological Process: epidermal growth factor receptor signaling pathway; transcription initiation from RNA polymerase II promoter; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; intracellular receptor-mediated signaling pathway; nerve growth factor receptor signaling pathway; signal transduction; cell migration during sprouting angiogenesis; innate immune response; positive regulation of transcription from RNA polymerase II promoter; gene expression; steroid hormone mediated signaling; positive regulation of endothelial cell proliferation

Research Articles on NR4A1

Similar Products

Product Notes

The NR4A1 nr4a1 (Catalog #AAA3201057) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR4A1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NR4A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR4A1 nr4a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RGRLPSKPKQ PPDASPANLL TSLVRAHLDS GPSTAKLDYS KFQELVLPHF. It is sometimes possible for the material contained within the vial of "NR4A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.