Western Blot (WB)
(Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M02), clone 4E4.Lane 1: TNIK transfected lysate(60.3 KDa).Lane 2: Non-transfected lysate.)
Mouse TNIK Monoclonal Antibody | anti-TNIK antibody
TNIK (TRAF2 and NCK Interacting Kinase) (Biotin)
Gene Names
TNIK; MRT54
Applications
Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
TNIK; Monoclonal Antibody; TNIK (TRAF2 and NCK Interacting Kinase) (Biotin); TRAF2 and NCK Interacting Kinase; anti-TNIK antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
40000
Specificity
Recognizes TNIK.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
538
Applicable Applications for anti-TNIK antibody
Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TNIK (AAH55427, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKKVTDYSSSSEESESSEEEEEDGESETHDGTVAVSDIPRLIPTGAPGSNEQYNVGMVGTHGLETSHADSFSGSISREGTLMIRETSGEKKRSGHSDSNGFAGHINLPDL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M02), clone 4E4.Lane 1: TNIK transfected lysate(60.3 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of TNIK expression in transfected 293T cell line by TNIK monoclonal antibody (M02), clone 4E4.Lane 1: TNIK transfected lysate(60.3 KDa).Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged TNIK is 0.3 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged TNIK is 0.3 ng/ml as a capture antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of TNIK transfected lysate using anti-TNIK monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TNIK monoclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of TNIK transfected lysate using anti-TNIK monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TNIK monoclonal antibody.)
Related Product Information for anti-TNIK antibody
Germinal center kinases (GCKs), such as TNIK, are characterized by an N-terminal kinase domain and a C-terminal GCK domain that serves a regulatory function (Fu et al., 1999 [PubMed 10521462]). [supplied by OMIM]
Product Categories/Family for anti-TNIK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
TNIK protein
NCBI Official Synonym Full Names
TRAF2 and NCK interacting kinase
NCBI Official Symbol
TNIK
NCBI Official Synonym Symbols
MRT54
NCBI Protein Information
TRAF2 and NCK-interacting protein kinase
Protein Family
NCBI Description
Wnt signaling plays important roles in carcinogenesis and embryonic development. The protein encoded by this gene is a serine/threonine kinase that functions as an activator of the Wnt signaling pathway. Mutations in this gene are associated with an autosomal recessive form of cognitive disability. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2017]
Research Articles on TNIK
Similar Products
Product Notes
The TNIK (Catalog #AAA6170701) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TNIK can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TNIK for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TNIK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
