Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type :Pig duodenum Primary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-biotin, streptavidin-HRP Secondary Antibody Dilution :1:500Color/Signal Descriptions :Brown: OATGene Name :OAT Submitted by :Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine )

Rabbit OAT Polyclonal Antibody | anti-OAT antibody

OAT antibody - C-terminal region

Gene Names
OAT; OKT; GACR; HOGA; OATASE
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
OAT; Polyclonal Antibody; OAT antibody - C-terminal region; anti-OAT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI
Sequence Length
439
Applicable Applications for anti-OAT antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human OAT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Pig duodenum Primary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-biotin, streptavidin-HRP Secondary Antibody Dilution :1:500Color/Signal Descriptions :Brown: OATGene Name :OAT Submitted by :Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine )

Immunohistochemistry (IHC) (Sample Type :Pig duodenum Primary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-biotin, streptavidin-HRP Secondary Antibody Dilution :1:500Color/Signal Descriptions :Brown: OATGene Name :OAT Submitted by :Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine )

Immunohistochemistry (IHC)

(Sample Type :Pig ileum Primary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-biotin, streptavidin-HRP Secondary Antibody Dilution :1:500Color/Signal Descriptions :Brown: OATGene Name :OATSubmitted by :Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine )

Immunohistochemistry (IHC) (Sample Type :Pig ileum Primary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-biotin, streptavidin-HRP Secondary Antibody Dilution :1:500Color/Signal Descriptions :Brown: OATGene Name :OATSubmitted by :Juan C. Mari, USDA/ARS Children's Nutrition Research Center Baylor College of Medicine )

Western Blot (WB)

(WB Suggested Anti-OAT Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-OAT Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-OAT antibody
This is a rabbit polyclonal antibody against OAT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: OAT is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy.This gene encodes the mitochondrial enzyme ornithine aminotransferase, which is a key enzyme is the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-42 DB459793.1 27-68 43-2062 BC016928.1 1-2020 2063-2066 M12267.1 2010-2013

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
ornithine aminotransferase, mitochondrial isoform 1
NCBI Official Synonym Full Names
ornithine aminotransferase
NCBI Official Symbol
OAT
NCBI Official Synonym Symbols
OKT; GACR; HOGA; OATASE
NCBI Protein Information
ornithine aminotransferase, mitochondrial
UniProt Protein Name
Ornithine aminotransferase, mitochondrial
UniProt Gene Name
OAT
UniProt Entry Name
OAT_HUMAN

NCBI Description

This gene encodes the mitochondrial enzyme ornithine aminotransferase, which is a key enzyme in the pathway that converts arginine and ornithine into the major excitatory and inhibitory neurotransmitters glutamate and GABA. Mutations that result in a deficiency of this enzyme cause the autosomal recessive eye disease Gyrate Atrophy. Alternatively spliced transcript variants encoding different isoforms have been described. Related pseudogenes have been defined on the X chromosome. [provided by RefSeq, Jan 2010]

Uniprot Description

OAT: Defects in OAT are the cause of hyperornithinemia with gyrate atrophy of choroid and retina (HOGA). HOGA is a slowly progressive blinding autosomal recessive disorder. Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; Amino Acid Metabolism - arginine and proline; EC 2.6.1.13; Mitochondrial

Chromosomal Location of Human Ortholog: 10q26

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: ornithine-oxo-acid transaminase activity; pyridoxal phosphate binding

Biological Process: visual perception; amino acid biosynthetic process

Disease: Gyrate Atrophy Of Choroid And Retina

Research Articles on OAT

Similar Products

Product Notes

The OAT oat (Catalog #AAA3208868) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OAT antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's OAT can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the OAT oat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRGKGLLNAI VIKETKDWDA WKVCLRLRDN GLLAKPTHGD IIRFAPPLVI. It is sometimes possible for the material contained within the vial of "OAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.