Immunohistochemistry (IHC)
(Rabbit Anti-NFE2L2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: Cytoplasm, NucleusPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Rabbit Nfe2l2 Polyclonal Antibody | anti-NFE2L2 antibody
Nfe2l2 Antibody - N-terminal region
Reactivity
Cow, Dog, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Nfe2l2; Polyclonal Antibody; Nfe2l2 Antibody - N-terminal region; anti-NFE2L2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQEQLQKEQE
Sequence Length
597
Applicable Applications for anti-NFE2L2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Human: 86%; Mouse: 100%; Rabbit: 92%; Rat: 100%; Yeast: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Nfe2l2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-NFE2L2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: Cytoplasm, NucleusPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Immunohistochemistry (IHC)
(Rabbit Anti-NFE2L2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Urinary Bladder TissueObserved Staining: Cytoplasm, NucleusPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Western Blot (WB)
(Host: RabbitTarget Name: Nfe2l2Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Nfe2l2Sample Type: Rat Thymus lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RatTarget Name: NFE2L2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RatTarget Name: NFE2L2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)
Related Product Information for anti-NFE2L2 antibody
This is a rabbit polyclonal antibody against Nfe2l2. It was validated on Western Blot
Target Description: Nfe2l2 is a basic leucine zipper transcription factor; It is involved in activating expression of genes with an antioxidant response element (ARE).
Target Description: Nfe2l2 is a basic leucine zipper transcription factor; It is involved in activating expression of genes with an antioxidant response element (ARE).
Product Categories/Family for anti-NFE2L2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
nuclear factor erythroid 2-related factor 2
NCBI Official Synonym Full Names
nuclear factor, erythroid 2-like 2
NCBI Official Symbol
Nfe2l2
NCBI Protein Information
nuclear factor erythroid 2-related factor 2
UniProt Protein Name
Nuclear factor erythroid 2-related factor 2
Protein Family
UniProt Gene Name
Nfe2l2
UniProt Synonym Gene Names
Nrf2; NF-E2-related factor 2; NFE2-related factor 2
NCBI Description
a basic leucine zipper transcription factor; involved in activating expression of genes with an antioxidant response element (ARE) [RGD, Feb 2006]
Uniprot Description
Transcription activator that binds to antioxidant response (ARE) elements in the promoter regions of target genes. Important for the coordinated up-regulation of genes in response to oxidative stress. May be involved in the transcriptional activation of genes of the beta-globin cluster by mediating enhancer activity of hypersensitive site 2 of the beta-globin locus control region ().
Research Articles on NFE2L2
Similar Products
Product Notes
The NFE2L2 nfe2l2 (Catalog #AAA3203461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nfe2l2 Antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's Nfe2l2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFE2L2 nfe2l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLIDILWRQD IDLGVSREVF DFSQRQKDYE LEKQKKLEKE RQEQLQKEQE. It is sometimes possible for the material contained within the vial of "Nfe2l2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
