Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PTPRC AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Ptprc Polyclonal Antibody | anti-PTPRC antibody

Ptprc Antibody - middle region

Gene Names
Ptprc; Lca; RT7; CD45; L-CA; T200
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ptprc; Polyclonal Antibody; Ptprc Antibody - middle region; anti-PTPRC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLVFLIIVTSIALLVVLYKIYDLRKKRSSNLDEQQELVERDEEKQLINVD
Sequence Length
1273
Applicable Applications for anti-PTPRC antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat Ptprc
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PTPRC AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-PTPRC AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: RabbitTarget Name: PtprcSample Type: Rat Spleen lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PtprcSample Type: Rat Spleen lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PTPRC antibody
This is a rabbit polyclonal antibody against Ptprc. It was validated on Western Blot

Target Description: Ptprc is a member of a family of heavily glycosylated leukocyte cell surface glycoproteins; It displays extensive O-glycosylation.
Product Categories/Family for anti-PTPRC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140kDa
NCBI Official Full Name
receptor-type tyrosine-protein phosphatase C isoform 4
NCBI Official Synonym Full Names
protein tyrosine phosphatase, receptor type, C
NCBI Official Symbol
Ptprc
NCBI Official Synonym Symbols
Lca; RT7; CD45; L-CA; T200
NCBI Protein Information
receptor-type tyrosine-protein phosphatase C
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase C
UniProt Gene Name
Ptprc
UniProt Synonym Gene Names
L-CA
UniProt Entry Name
PTPRC_RAT

NCBI Description

member of a family of heavily glycosylated leukocyte cell surface glycoproteins; displays extensive O-glycosylation [RGD, Feb 2006]

Uniprot Description

CD45: a receptor type protein tyrosine phosphatase protein. Contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains. The first PTPAse domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Specifically expressed in hematopoietic cells. An essential regulator of T- and B-cell antigen receptor signaling. Functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. Suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Four alternatively spliced isoforms have been described.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Receptor protein phosphatase, tyrosine; EC 3.1.3.48

Cellular Component: internal side of plasma membrane; cell surface; focal adhesion; membrane; integral to plasma membrane; integral to membrane; plasma membrane; intracellular; cytosol; lipid raft; external side of plasma membrane

Molecular Function: heparin binding; heparan sulfate proteoglycan binding; protein binding; transmembrane receptor protein tyrosine phosphatase activity; protein tyrosine phosphatase activity; protein kinase regulator activity; protein kinase binding

Biological Process: B cell proliferation; positive regulation of isotype switching to IgG isotypes; activation of MAPK activity; regulation of humoral immune response mediated by circulating immunoglobulin; positive regulation of T cell mediated cytotoxicity; regulation of cell cycle; protein amino acid dephosphorylation; T cell receptor signaling pathway; T cell proliferation; leukocyte adhesion; B cell receptor signaling pathway; positive regulation of MAPKKK cascade; negative regulation of T cell mediated cytotoxicity; positive regulation of B cell proliferation; response to gamma radiation; positive regulation of T cell mediated immunity; positive regulation of T cell proliferation; negative regulation of protein amino acid autophosphorylation; negative regulation of cytokine and chemokine mediated signaling pathway; positive regulation of gamma-delta T cell differentiation; defense response to virus; positive thymic T cell selection; T cell differentiation; regulation of B cell receptor signaling pathway; positive regulation of humoral immune response mediated by circulating immunoglobulin; negative regulation of peptidyl-tyrosine phosphorylation; substrate-bound cell migration, cell release from substrate; negative thymic T cell selection; positive regulation of antigen receptor-mediated signaling pathway; bone marrow development; heterotypic cell-cell adhesion; stem cell development; positive regulation of T cell differentiation; dephosphorylation; B cell differentiation; release of sequestered calcium ion into cytosol; regulation of B cell differentiation; negative regulation of protein kinase activity; positive regulation of alpha-beta T cell proliferation; hemopoietic progenitor cell differentiation; immunoglobulin biosynthetic process

Research Articles on PTPRC

Similar Products

Product Notes

The PTPRC ptprc (Catalog #AAA3214186) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ptprc Antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ptprc can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTPRC ptprc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLVFLIIVTS IALLVVLYKI YDLRKKRSSN LDEQQELVER DEEKQLINVD. It is sometimes possible for the material contained within the vial of "Ptprc, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.