Immunohistochemistry (IHC)
(Rabbit Anti-NET1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Rabbit NET1 Polyclonal Antibody | anti-NET1 antibody
NET1 antibody - middle region
Gene Names
NET1; NET1A; ARHGEF8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NET1; Polyclonal Antibody; NET1 antibody - middle region; anti-NET1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AILIIQGVLSDINLKKGESECQYYIDKLEYLDEKQRDPRIEASKVLLCHG
Sequence Length
542
Applicable Applications for anti-NET1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 100%; Yeast: 90%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NET1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-NET1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Immunohistochemistry (IHC)
(Rabbit Anti-NET1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Immunohistochemistry (IHC)
(Rabbit Anti-NET1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Immunohistochemistry (IHC)
(Rabbit Anti-NET1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult Small intestineObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Western Blot (WB)
(WB Suggested Anti-NET1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-NET1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-NET1 antibody
This is a rabbit polyclonal antibody against NET1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: NET1 acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. It may be involved in activation of the SAPK/JNK pathway.
Target Description: NET1 acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. It may be involved in activation of the SAPK/JNK pathway.
Product Categories/Family for anti-NET1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
62kDa
NCBI Official Full Name
neuroepithelial cell-transforming gene 1 protein isoform 2
NCBI Official Synonym Full Names
neuroepithelial cell transforming 1
NCBI Official Symbol
NET1
NCBI Official Synonym Symbols
NET1A; ARHGEF8
NCBI Protein Information
neuroepithelial cell-transforming gene 1 protein
UniProt Protein Name
Neuroepithelial cell transforming gene 1, isoform CRA_a
Protein Family
UniProt Gene Name
NET1
UniProt Entry Name
Q5SQI7_HUMAN
NCBI Description
This gene is part of the family of Rho guanine nucleotide exchange factors. Members of this family activate Rho proteins by catalyzing the exchange of GDP for GTP. The protein encoded by this gene interacts with RhoA within the cell nucleus and may play a role in repairing DNA damage after ionizing radiation. Pseudogenes of this gene are located on the long arms of chromosomes 1, 7 and 18. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]
Research Articles on NET1
Similar Products
Product Notes
The NET1 net1 (Catalog #AAA3210621) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NET1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NET1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the NET1 net1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AILIIQGVLS DINLKKGESE CQYYIDKLEY LDEKQRDPRI EASKVLLCHG. It is sometimes possible for the material contained within the vial of "NET1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
