Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-TCTN3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Plasma membrane and cytoplasm in hepatocytesPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit TCTN3 Polyclonal Antibody | anti-TCTN3 antibody

TCTN3 antibody - middle region

Gene Names
TCTN3; OFD4; TECT3; JBTS18; C10orf61
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TCTN3; Polyclonal Antibody; TCTN3 antibody - middle region; anti-TCTN3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LTYFPKWSVISLLRQPAGVGAGGLCAESNPAGFLESKSTTCTRFFKNLAS
Sequence Length
607
Applicable Applications for anti-TCTN3 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TCTN3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-TCTN3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Plasma membrane and cytoplasm in hepatocytesPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-TCTN3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Plasma membrane and cytoplasm in hepatocytesPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-TCTN3 antibody
This is a rabbit polyclonal antibody against TCTN3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TCTN3 may be involved in apoptosis regulation.
Product Categories/Family for anti-TCTN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
tectonic-3 isoform a
NCBI Official Synonym Full Names
tectonic family member 3
NCBI Official Symbol
TCTN3
NCBI Official Synonym Symbols
OFD4; TECT3; JBTS18; C10orf61
NCBI Protein Information
tectonic-3
UniProt Protein Name
Tectonic-3
Protein Family
UniProt Gene Name
TCTN3
UniProt Synonym Gene Names
C10orf61; TECT3
UniProt Entry Name
TECT3_HUMAN

NCBI Description

This gene encodes a member of the tectonic gene family which functions in Hedgehog signal transduction and development of the neural tube. Mutations in this gene have been associated with Orofaciodigital Syndrome IV and Joubert Syndrom 18. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2012]

Uniprot Description

TCTN3: Part of the tectonic-like complex which is required for tissue-specific ciliogenesis and may regulate ciliary membrane composition. May be involved in apoptosis regulation. Belongs to the tectonic family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10q24.1

Cellular Component: integral to membrane

Biological Process: smoothened signaling pathway; apoptosis; organelle organization and biogenesis

Disease: Joubert Syndrome 18; Joubert Syndrome 1; Orofaciodigital Syndrome Iv

Research Articles on TCTN3

Similar Products

Product Notes

The TCTN3 tctn3 (Catalog #AAA3207480) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCTN3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TCTN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the TCTN3 tctn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTYFPKWSVI SLLRQPAGVG AGGLCAESNP AGFLESKSTT CTRFFKNLAS. It is sometimes possible for the material contained within the vial of "TCTN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.