Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-HIPK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Nuclear in pinealocytes & intersticial cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit HIPK2 Polyclonal Antibody | anti-HIPK2 antibody

HIPK2 Antibody - middle region

Gene Names
HIPK2; PRO0593
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
HIPK2; Polyclonal Antibody; HIPK2 Antibody - middle region; anti-HIPK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGTKTTR
Sequence Length
1198
Applicable Applications for anti-HIPK2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 87%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human HIPK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-HIPK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Nuclear in pinealocytes & intersticial cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-HIPK2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Nuclear in pinealocytes & intersticial cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-HIPK2 antibody
This is a rabbit polyclonal antibody against HIPK2. It was validated on Western Blot

Target Description: HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
120kDa
NCBI Official Full Name
homeodomain-interacting protein kinase 2 isoform 1
NCBI Official Synonym Full Names
homeodomain interacting protein kinase 2
NCBI Official Symbol
HIPK2
NCBI Official Synonym Symbols
PRO0593
NCBI Protein Information
homeodomain-interacting protein kinase 2
UniProt Protein Name
Homeodomain-interacting protein kinase 2
UniProt Gene Name
HIPK2
UniProt Synonym Gene Names
hHIPk2
UniProt Entry Name
HIPK2_HUMAN

NCBI Description

This gene encodes a conserved serine/threonine kinase that is a member of the homeodomain-interacting protein kinase family. The encoded protein interacts with homeodomain transcription factors and many other transcription factors such as p53, and can function as both a corepressor and a coactivator depending on the transcription factor and its subcellular localization. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

HIPK2: homeodomain interacting protein kinase 2 is a CMGC kinase of the DYRK family. Interacts with TRADD. Acts as a corepressor of several transcription factors, including SMAD1 and POU4F1/Brn3a and probably NK homeodomain transcription factors. Inhibits cell growth and promotes apoptosis. Involved in transcriptional activation of TP53 and TP73. In response to TGFB, cooperates with DAXX to activate JNK. Phosphorylates the antiapoptotic factor CTBP1 and promotes its proteasomal degradation. In the Wnt/beta-catenin signaling pathway acts as an intermediate kinase between TAK1 and NLK to promote the proteasomal degradation of MYB. Highly expressed in neuronal tissues, heart and kidney. Weakly expressed ubiquitously. Possible tumor suppressor. Activates p53 in response to UV light, causing growth arrest and apoptosis. Required for cisplatin-induced apoptosis. Downregulated in breast and thyroid carcinomas. Three alternatively spliced isoforms have been described.

Protein type: Protein kinase, CMGC; EC 2.7.11.1; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); CMGC group; DYRK family; HIPK subfamily

Chromosomal Location of Human Ortholog: 7q34

Cellular Component: nuclear body; PML body; cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; virion binding; SMAD binding; transcription corepressor activity; ATP binding; protein kinase activity

Biological Process: voluntary musculoskeletal movement; positive regulation of protein binding; regulation of cell cycle; positive regulation of transcription, DNA-dependent; positive regulation of JNK cascade; PML body organization and biogenesis; negative regulation of transcription from RNA polymerase II promoter; protein amino acid phosphorylation; adult walking behavior; negative regulation of BMP signaling pathway; neuron differentiation; anterior/posterior pattern formation; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; transforming growth factor beta receptor signaling pathway; positive regulation of cell proliferation; erythrocyte differentiation; negative regulation of neuron apoptosis; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; positive regulation of DNA binding; smoothened signaling pathway; transcription, DNA-dependent; positive regulation of transforming growth factor beta receptor signaling pathway; peptidyl-threonine phosphorylation; peptidyl-serine phosphorylation; positive regulation of angiogenesis; eye development; virus-host interaction; embryonic retina morphogenesis in camera-type eye; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; embryonic camera-type eye morphogenesis; positive regulation of protein amino acid phosphorylation

Research Articles on HIPK2

Similar Products

Product Notes

The HIPK2 hipk2 (Catalog #AAA3201033) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIPK2 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HIPK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the HIPK2 hipk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MWSLGCVIAE LFLGWPLYPG ASEYDQIRYI SQTQGLPAEY LLSAGTKTTR. It is sometimes possible for the material contained within the vial of "HIPK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.