<
Immunohistochemistry (IHC)
(Rabbit Anti-GABPA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Rabbit Gabpa Polyclonal Antibody | anti-GABPA antibody
Gabpa Antibody - N-terminal region
Gene Names
Gabpa; GABPalpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Gabpa; Polyclonal Antibody; Gabpa Antibody - N-terminal region; anti-GABPA antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGN
Sequence Length
454
Applicable Applications for anti-GABPA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Gabpa
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-GABPA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Immunohistochemistry (IHC)
(Rabbit Anti-GABPA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lymph Node TissueObserved Staining: NucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Western Blot (WB)
(Host: RabbitTarget Name: GabpaSample Type: Mouse Lung lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GabpaSample Type: Mouse Lung lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-Gabpa antibody Titration: 1 ug/mLSample Type: Human heart)
Western Blot (WB)
(WB Suggested Anti-Gabpa antibody Titration: 1 ug/mLSample Type: Human heart)
Western Blot (WB)
(WB Suggested Anti-Gabpa antibody Titration: 1 ug/mLSample Type: Human liver)
Western Blot (WB)
(WB Suggested Anti-Gabpa antibody Titration: 1 ug/mLSample Type: Human liver)
Related Product Information for anti-GABPA antibody
This is a rabbit polyclonal antibody against Gabpa. It was validated on Western Blot
Target Description: Gabpa is a transcription factor capable of interacting with purine rich repeats (GA repeats).
Target Description: Gabpa is a transcription factor capable of interacting with purine rich repeats (GA repeats).
Product Categories/Family for anti-GABPA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
GA-binding protein alpha chain
NCBI Official Synonym Full Names
GA repeat binding protein, alpha
NCBI Official Symbol
Gabpa
NCBI Official Synonym Symbols
GABPalpha
NCBI Protein Information
GA-binding protein alpha chain
UniProt Protein Name
GA-binding protein alpha chain
Protein Family
UniProt Gene Name
Gabpa
UniProt Synonym Gene Names
E4tf1a; GABP subunit alpha
UniProt Entry Name
GABPA_MOUSE
Research Articles on GABPA
Similar Products
Product Notes
The GABPA gabpa (Catalog #AAA3200355) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Gabpa Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Gabpa can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GABPA gabpa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTKREAEELI EIEIDGTEKA ECTEESIVEQ TYTPAECVSQ AIDINEPIGN. It is sometimes possible for the material contained within the vial of "Gabpa, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
