Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MRGPRX1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Small Intestine)

Rabbit anti-Human MRGPRX1 Polyclonal Antibody | anti-MRGPRX1 antibody

MRGPRX1 Antibody - C-terminal region

Gene Names
MRGPRX1; GPCR; MGRG2; MRGX1; SNSR4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRGPRX1; Polyclonal Antibody; MRGPRX1 Antibody - C-terminal region; anti-MRGPRX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDASEVDEGGGQL
Sequence Length
322
Applicable Applications for anti-MRGPRX1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRGPRX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MRGPRX1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Small Intestine)

Western Blot (WB) (WB Suggested Anti-MRGPRX1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Small Intestine)
Related Product Information for anti-MRGPRX1 antibody
This is a rabbit polyclonal antibody against MRGPRX1. It was validated on Western Blot

Target Description: MRGPRX1 is an orphan receptor. MRGPRX1 is probably involved in the function of nociceptive neurons. It may regulate nociceptor function and/or development, including the sensation or modulation of pain. MRGPRX1 is potently activated by enkephalins including BAM22 (bovine adrenal medulla peptide 22) and BAM (8-22). BAM22 is the most potent compound and evoked a large and dose-dependent release of intracellular calcium in stably transfected cells. G(alpha)q proteins are involved in the calcium-signaling pathway. MRGPRX1 is activated by the antimalarial drug, chloroquine and may mediate chloroquine-induced itch, in an histamine-independent manner.
Product Categories/Family for anti-MRGPRX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
mas-related G-protein coupled receptor member X1
NCBI Official Synonym Full Names
MAS related GPR family member X1
NCBI Official Symbol
MRGPRX1
NCBI Official Synonym Symbols
GPCR; MGRG2; MRGX1; SNSR4
NCBI Protein Information
mas-related G-protein coupled receptor member X1
UniProt Protein Name
Mas-related G-protein coupled receptor member X1
UniProt Gene Name
MRGPRX1
UniProt Synonym Gene Names
MRGX1; SNSR3; SNSR4
UniProt Entry Name
MRGX1_HUMAN

Uniprot Description

MRGPRX1: Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Potently activated by enkephalins including BAM22 (bovine adrenal medulla peptide 22) and BAM (8-22). BAM22 is the most potent compound and evoked a large and dose-dependent release of intracellular calcium in stably transfected cells. G(alpha)q proteins are involved in the calcium-signaling pathway. Activated by the antimalarial drug, chloroquine. May mediate chloroquine- induced itch, in an histamine-independent manner. Belongs to the G-protein coupled receptor 1 family. Mas subfamily.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11p15.1|11

Cellular Component: integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; acute-phase response

Research Articles on MRGPRX1

Similar Products

Product Notes

The MRGPRX1 mrgprx1 (Catalog #AAA3214572) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRGPRX1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRGPRX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRGPRX1 mrgprx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLSALNSSAN PIIYFFVGSF RQRQNRQNLK LVLQRALQDA SEVDEGGGQL. It is sometimes possible for the material contained within the vial of "MRGPRX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.