Western Blot (WB)
(WB Suggested Anti-MRGPRX4 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Rabbit MRGPRX4 Polyclonal Antibody | anti-MRGPRX4 antibody
MRGPRX4 antibody - C-terminal region
Gene Names
MRGPRX4; GPCR; MRGX4; SNSR6
Reactivity
Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRGPRX4; Polyclonal Antibody; MRGPRX4 antibody - C-terminal region; anti-MRGPRX4 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FFVGSFRQRQNRQNLKLVLQRALQDKPEVDKGEGQLPEESLELSGSRLGP
Sequence Length
322
Applicable Applications for anti-MRGPRX4 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 79%; Rabbit: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MRGPRX4 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-MRGPRX4 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Related Product Information for anti-MRGPRX4 antibody
This is a rabbit polyclonal antibody against MRGPRX4. It was validated on Western Blot
Target Description: MRGPRX4 is an orphan receptor. It is probably involved in the function of nociceptive neurons. MRGPRX4 may regulate nociceptor function and/or development, including the sensation or modulation of pain. MRGPRX4 is potently activated by enkephalins.
Target Description: MRGPRX4 is an orphan receptor. It is probably involved in the function of nociceptive neurons. MRGPRX4 may regulate nociceptor function and/or development, including the sensation or modulation of pain. MRGPRX4 is potently activated by enkephalins.
Product Categories/Family for anti-MRGPRX4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
mas-related G-protein coupled receptor member X4
NCBI Official Synonym Full Names
MAS related GPR family member X4
NCBI Official Symbol
MRGPRX4
NCBI Official Synonym Symbols
GPCR; MRGX4; SNSR6
NCBI Protein Information
mas-related G-protein coupled receptor member X4
UniProt Protein Name
Mas-related G-protein coupled receptor member X4
Protein Family
UniProt Gene Name
MRGPRX4
UniProt Synonym Gene Names
MRGX4; SNSR5; SNSR6
UniProt Entry Name
MRGX4_HUMAN
Uniprot Description
MRGPRX4: Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Potently activated by enkephalins. Belongs to the G-protein coupled receptor 1 family. Mas subfamily.
Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral
Chromosomal Location of Human Ortholog: 11p15.1
Cellular Component: integral to membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity
Biological Process: G-protein coupled receptor protein signaling pathway
Research Articles on MRGPRX4
Similar Products
Product Notes
The MRGPRX4 mrgprx4 (Catalog #AAA3214573) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRGPRX4 antibody - C-terminal region reacts with Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's MRGPRX4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRGPRX4 mrgprx4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FFVGSFRQRQ NRQNLKLVLQ RALQDKPEVD KGEGQLPEES LELSGSRLGP. It is sometimes possible for the material contained within the vial of "MRGPRX4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
