Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MLSTD2 antibody (MBS5303500) used at 1.25 ug/ml to detect target protein.)

Rabbit MLSTD2 Polyclonal Antibody | anti-MLSTD2 antibody

MLSTD2 antibody

Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
MLSTD2; Polyclonal Antibody; MLSTD2 antibody; Polyclonal MLSTD2; Anti-MLSTD2; MLSTD 2; FLJ33561; DKFZp686P18247; MLSTD-2; FAR1; FLJ22728; DKFZp686A0370; anti-MLSTD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
MLSTD2 antibody was raised against the N terminal Of Mlstd2
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of MLSTD2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-MLSTD2 antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.
Cross-Reactivity
Human, Mouse, Rat
Immunogen
MLSTD2 antibody was raised using the N terminal Of Mlstd2 corresponding to a region with amino acids LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(MLSTD2 antibody (MBS5303500) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (MLSTD2 antibody (MBS5303500) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-MLSTD2 antibody
Rabbit polyclonal MLSTD2 antibody raised against the N terminal Of Mlstd2
Product Categories/Family for anti-MLSTD2 antibody

Similar Products

Product Notes

The MLSTD2 (Catalog #AAA5303500) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MLSTD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the MLSTD2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MLSTD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.