Western Blot (WB)
(WB Suggested Anti-MLSTD2 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Rabbit MLSTD2 Polyclonal Antibody | anti-FAR1 antibody
MLSTD2 antibody - N-terminal region
Gene Names
FAR1; PFCRD; MLSTD2; SDR10E1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
MLSTD2; Polyclonal Antibody; MLSTD2 antibody - N-terminal region; anti-FAR1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: LRSCPKVNSVYVLVRQKAGQTPQERVEEVLSGKLFDRLRDENPDFREKII
Sequence Length
515
Applicable Applications for anti-FAR1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MLSTD2
Blocking Peptide
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MLSTD2 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-MLSTD2 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-FAR1 antibody
This is a rabbit polyclonal antibody against MLSTD2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.
Target Description: MLSTD2 catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.
Product Categories/Family for anti-FAR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
fatty acyl-CoA reductase 1
NCBI Official Synonym Full Names
fatty acyl-CoA reductase 1
NCBI Official Symbol
FAR1
NCBI Official Synonym Symbols
PFCRD; MLSTD2; SDR10E1
NCBI Protein Information
fatty acyl-CoA reductase 1
UniProt Protein Name
Fatty acyl-CoA reductase 1
Protein Family
UniProt Gene Name
FAR1
UniProt Synonym Gene Names
MLSTD2; UNQ2423/PRO4981
UniProt Entry Name
FACR1_HUMAN
NCBI Description
The protein encoded by this gene is required for the reduction of fatty acids to fatty alcohols, a process that is required for the synthesis of monoesters and ether lipids. NADPH is required as a cofactor in this reaction, and 16-18 carbon saturated and unsaturated fatty acids are the preferred substrate. This is a peroxisomal membrane protein, and studies suggest that the N-terminus contains a large catalytic domain located on the outside of the peroxisome, while the C-terminus is exposed to the matrix of the peroxisome. Studies indicate that the regulation of this protein is dependent on plasmalogen levels. Mutations in this gene have been associated with individuals affected by severe intellectual disability, early-onset epilepsy, microcephaly, congenital cataracts, growth retardation, and spasticity (PMID: 25439727). A pseudogene of this gene is located on chromosome 13. [provided by RefSeq, Jan 2015]
Research Articles on FAR1
Similar Products
Product Notes
The FAR1 far1 (Catalog #AAA3209766) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLSTD2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MLSTD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAR1 far1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRSCPKVNSV YVLVRQKAGQ TPQERVEEVL SGKLFDRLRD ENPDFREKII. It is sometimes possible for the material contained within the vial of "MLSTD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
