Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ZNF207 monoclonal antibody Western Blot analysis of ZNF207 expression in Hela NE.)

Mouse anti-Human ZNF207 Monoclonal Antibody | anti-ZNF207 antibody

ZNF207 (Zinc Finger Protein 207)

Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ZNF207; Monoclonal Antibody; ZNF207 (Zinc Finger Protein 207); Anti -ZNF207 (Zinc Finger Protein 207); anti-ZNF207 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D7
Specificity
Recognizes human ZNF207.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQ*
Applicable Applications for anti-ZNF207 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa1-111 from human ZNF207 (NP_003448) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ZNF207 monoclonal antibody Western Blot analysis of ZNF207 expression in Hela NE.)

Western Blot (WB) (ZNF207 monoclonal antibody Western Blot analysis of ZNF207 expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ZNF207 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to ZNF207 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml])

Western Blot (WB)

(Western Blot analysis of ZNF207 expression in transfected 293T cell line by ZNF207 monoclonal antibody.|Lane 1: ZNF207 transfected lysate (49.7kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZNF207 expression in transfected 293T cell line by ZNF207 monoclonal antibody.|Lane 1: ZNF207 transfected lysate (49.7kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZNF207 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to ZNF207 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-ZNF207 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,751 Da
NCBI Official Full Name
zinc finger protein 207 isoform c
NCBI Official Synonym Full Names
zinc finger protein 207
NCBI Official Symbol
ZNF207
NCBI Protein Information
zinc finger protein 207
UniProt Protein Name
Zinc finger protein 207
UniProt Gene Name
ZNF207
UniProt Entry Name
ZN207_HUMAN

Uniprot Description

ZNF207: 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Spliceosome; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: kinetochore; microtubule; nucleolus; nucleus

Molecular Function: heparin binding; protein binding; DNA binding; zinc ion binding; microtubule binding; transcription factor activity

Biological Process: protein stabilization; regulation of transcription, DNA-dependent; mitotic sister chromatid segregation; cell division; mitotic cell cycle spindle assembly checkpoint; regulation of chromosome segregation; attachment of spindle microtubules to kinetochore

Similar Products

Product Notes

The ZNF207 znf207 (Catalog #AAA6000945) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF207 (Zinc Finger Protein 207) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF207 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the ZNF207 znf207 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGRKKKKQLK PWCWYCNRDF DDEKILIQHQ KAKHFKCHIC HKKLYTGPGL AIHCMQVHKE TIDAVPNAIP GRTDIELEIY GMEGIPEKDM DERRRLLEQK TQESQKKKQQ *. It is sometimes possible for the material contained within the vial of "ZNF207, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.