Mouse anti-Human ZNF207 Monoclonal Antibody | anti-ZNF207 antibody

ZNF207 (Zinc Finger Protein 207)

Cat. Num. AAA6000945

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ZNF207; Monoclonal Antibody; ZNF207 (Zinc Finger Protein 207); Anti -ZNF207 (Zinc Finger Protein 207); anti-ZNF207 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6D7
• Specificity: Recognizes human ZNF207.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQ*

• Applicable Applications for anti-ZNF207 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa1-111 from human ZNF207 (NP_003448) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ZNF207 monoclonal antibody Western Blot analysis of ZNF207 expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ZNF207 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3ug/ml])

Western Blot (WB)

(Western Blot analysis of ZNF207 expression in transfected 293T cell line by ZNF207 monoclonal antibody.|Lane 1: ZNF207 transfected lysate (49.7kD).|Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ZNF207 on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-ZNF207 antibody

Antibodies; Abs to Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 148612835
• NCBI GeneID: 7756
• NCBI Accession #: NP_001091977.1
• NCBI GenBank Nucleotide #: NM_001098507.1
• UniProt Accession #: O43670; Q53XS9; Q96HW5; Q9BUQ7; A8K6Y6; E1P660; E1P661; E1P662
• Molecular Weight: 50,751 Da
• NCBI Official Full Name: zinc finger protein 207 isoform c
• NCBI Official Synonym Full Names: zinc finger protein 207
• NCBI Official Symbol: ZNF207
• NCBI Protein Information: zinc finger protein 207
• UniProt Protein Name: Zinc finger protein 207
• Protein Family: BUB3-interacting and GLEBS motif-containing protein
• UniProt Gene Name: ZNF207
• UniProt Entry Name: ZN207_HUMAN

Uniprot Description

ZNF207: 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Spliceosome; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: kinetochore; microtubule; nucleolus; nucleus

Molecular Function: heparin binding; protein binding; DNA binding; zinc ion binding; microtubule binding; transcription factor activity

Biological Process: protein stabilization; regulation of transcription, DNA-dependent; mitotic sister chromatid segregation; cell division; mitotic cell cycle spindle assembly checkpoint; regulation of chromosome segregation; attachment of spindle microtubules to kinetochore