Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FLJ22167 antibody (MBS839745) used at 1.25 ug/ml to detect target protein.)

Rabbit anti-Human, Dog FLJ22167 Polyclonal Antibody | anti-FLJ22167 antibody

FLJ22167 antibody

Gene Names
TMEM231; MKS11; JBTS20; ALYE870; PRO1886
Reactivity
Human, Dog
Applications
Western Blot, Immunohistochemistry
Purity
Total IgG Protein A purified
Synonyms
FLJ22167; Polyclonal Antibody; FLJ22167 antibody; Polyclonal FLJ22167; Anti-FLJ22167; FLJ 22167; FLJ-22167; ALYE870; PRO1886; Hypothetical Protein Flj22167; anti-FLJ22167 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Dog
Clonality
Polyclonal
Specificity
FLJ22167 antibody was raised against the N terminal of FLJ22167
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FLJ22167 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
219
Applicable Applications for anti-FLJ22167 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1.25 ug/ml
IHC: 4-8 ug/ml
Biological Significance
The FLJ22167 protein catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. FLJ22167 acts on the non-reducing terminal GlcNAc of short carbohydrate substrates.
Cross-Reactivity
Human,Dog
Immunogen
FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(FLJ22167 antibody (MBS839745) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (FLJ22167 antibody (MBS839745) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-FLJ22167 antibody
Rabbit polyclonal FLJ22167 antibody raised against the N terminal of FLJ22167
Product Categories/Family for anti-FLJ22167 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
36 kDa (MW of target protein)
NCBI Official Full Name
FLJ22167 protein, partial
NCBI Official Synonym Full Names
transmembrane protein 231
NCBI Official Symbol
TMEM231
NCBI Official Synonym Symbols
MKS11; JBTS20; ALYE870; PRO1886
NCBI Protein Information
transmembrane protein 231
UniProt Protein Name
Transmembrane protein 231
UniProt Gene Name
TMEM231
UniProt Entry Name
TM231_HUMAN

NCBI Description

This gene encodes a transmembrane protein, which is a component of the B9 complex involved in the formation of the diffusion barrier between the cilia and plasma membrane. Mutations in this gene cause Joubert syndrome (JBTS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2013]

Uniprot Description

TMEM231: Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. Required for ciliogenesis and sonic hedgehog/SHH signaling. Belongs to the TMEM231 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16q23.1

Cellular Component: integral to membrane

Biological Process: smoothened signaling pathway; cilium biogenesis

Disease: Joubert Syndrome 1; Meckel Syndrome, Type 11; Joubert Syndrome 20

Research Articles on FLJ22167

Similar Products

Product Notes

The FLJ22167 tmem231 (Catalog #AAA839745) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FLJ22167 antibody reacts with Human, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's FLJ22167 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1.25 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the FLJ22167 tmem231 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FLJ22167, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.