Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LYL1Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human, Pig LYL1 Polyclonal Antibody | anti-LYL1 antibody

LYL1 Antibody - C-terminal region

Gene Names
LYL1; bHLHa18
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LYL1; Polyclonal Antibody; LYL1 Antibody - C-terminal region; anti-LYL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
Sequence Length
280
Applicable Applications for anti-LYL1 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LYL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LYL1Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LYL1Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-LYL1 antibody
This is a rabbit polyclonal antibody against LYL1. It was validated on Western Blot

Target Description: This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia.
Product Categories/Family for anti-LYL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
protein lyl-1
NCBI Official Synonym Full Names
LYL1 basic helix-loop-helix family member
NCBI Official Symbol
LYL1
NCBI Official Synonym Symbols
bHLHa18
NCBI Protein Information
protein lyl-1
UniProt Protein Name
Protein lyl-1
Protein Family
UniProt Gene Name
LYL1
UniProt Synonym Gene Names
BHLHA18; bHLHa18
UniProt Entry Name
LYL1_HUMAN

NCBI Description

This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia. [provided by RefSeq, Sep 2010]

Uniprot Description

LYL1: A chromosomal aberration involving LYL1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(7;19)(q35;p13) with TCRB.

Protein type: DNA-binding; Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleus

Molecular Function: protein dimerization activity; protein binding; DNA binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; B cell differentiation; blood vessel maturation

Research Articles on LYL1

Similar Products

Product Notes

The LYL1 lyl1 (Catalog #AAA3200312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LYL1 Antibody - C-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's LYL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LYL1 lyl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDDGARRGSG RRAEAAARSQ PAPPADPDGS PGGAARPIKM EQTALSPEVR. It is sometimes possible for the material contained within the vial of "LYL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.