Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: TAL1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Rabbit TAL1 Polyclonal Antibody | anti-TAL1 antibody

TAL1 antibody - middle region

Gene Names
TAL1; SCL; TCL5; tal-1; bHLHa17
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
TAL1; Polyclonal Antibody; TAL1 antibody - middle region; anti-TAL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: INFLAKLLNDQEEEGTQRAKTGKDPVVGAGGGGGGGGGGAPPDDLLQDVL
Sequence Length
331
Applicable Applications for anti-TAL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TAL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TAL1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TAL1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TAL1 AntibodyTitration: 5 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-TAL1 AntibodyTitration: 5 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-TAL1 antibody
This is a rabbit polyclonal antibody against TAL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TAL1 is a basic helix-loop-helix transcription factor with a critical role in the development of both blood and endothelium

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
T-cell acute lymphocytic leukemia protein 1 isoform 1
NCBI Official Synonym Full Names
TAL bHLH transcription factor 1, erythroid differentiation factor
NCBI Official Symbol
TAL1
NCBI Official Synonym Symbols
SCL; TCL5; tal-1; bHLHa17
NCBI Protein Information
T-cell acute lymphocytic leukemia protein 1
UniProt Protein Name
T-cell acute lymphocytic leukemia protein 1
Protein Family
UniProt Gene Name
TAL1
UniProt Synonym Gene Names
BHLHA17; SCL; TCL5; TAL-1; bHLHa17
UniProt Entry Name
TAL1_HUMAN

Uniprot Description

TAL1: a basic helix-loop-helix transcription. Regulates differentiation and survival during hemopoiesis. Implicated in the genesis of hemopoietic malignancies. It may play an important role in hemopoietic differentiation. Serves as a positive regulator of eryhtroid differentiation. Mutations are associated with T-cell leukemia and melanoma. Binds to the LIM domain containing protein Rhombotin-2.

Protein type: DNA-binding; Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: 1p32

Cellular Component: transcription factor complex; histone deacetylase complex; nuclear chromatin; nucleus

Molecular Function: protein binding; enzyme binding; protein heterodimerization activity; histone deacetylase binding; chromatin binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; erythrocyte maturation; cell fate commitment; positive regulation of chromatin assembly or disassembly; embryonic hemopoiesis; megakaryocyte differentiation; positive regulation of transcription, DNA-dependent; positive regulation of erythrocyte differentiation; astrocyte fate commitment; locomotory behavior; negative regulation of transcription from RNA polymerase II promoter; positive regulation of mitotic cell cycle; regulation of cell proliferation; regulation of transcription from RNA polymerase II promoter; positive regulation of protein complex assembly; positive regulation of cell division; erythrocyte differentiation; spinal cord association neuron differentiation; hemopoiesis; positive regulation of transcription from RNA polymerase II promoter; angiogenesis; platelet formation; basophil differentiation

Disease: Leukemia, Acute Lymphoblastic

Research Articles on TAL1

Similar Products

Product Notes

The TAL1 tal1 (Catalog #AAA3224701) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAL1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAL1 tal1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: INFLAKLLND QEEEGTQRAK TGKDPVVGAG GGGGGGGGGA PPDDLLQDVL. It is sometimes possible for the material contained within the vial of "TAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.