Western Blot (WB)
(Host: RabbitTarget Name: FiglaSample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Mouse, Rat Figla Polyclonal Antibody | anti-FIGLA antibody
Figla Antibody - C-terminal region
Gene Names
Figla; bHLHc8; FIGalpha
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Figla; Polyclonal Antibody; Figla Antibody - C-terminal region; anti-FIGLA antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSTRELLGNATQPTSCASGLKKEEEGPWAYAGHSEPLYSYHQSTVPETRS
Sequence Length
194
Applicable Applications for anti-FIGLA antibody
Western Blot (WB)
Homology
Mouse: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Figla
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: FiglaSample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: FiglaSample Type: Mouse Spleen lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-FIGLA antibody
This is a rabbit polyclonal antibody against Figla. It was validated on Western Blot
Target Description: Figla is a germ-line specific transcription factor implicated in postnatal oocyte-specific gene expression. It plays a key regulatory role in the expression of multiple oocyte-specific genes, including those that initiate folliculogenesis and those that encode the zona pellucida (ZP1, ZP2 and ZP3) required for fertilization and early embryonic survival. It is essential for oocytes to survive and form primordial follicles. The persistence of FIGLA in adult females suggests that it may regulate additional pathways that are essential for normal ovarian development. Figla binds to the E-box (5'-CANNTG-3') of the ZPs (ZP1, ZP2, ZP3) promoters.
Target Description: Figla is a germ-line specific transcription factor implicated in postnatal oocyte-specific gene expression. It plays a key regulatory role in the expression of multiple oocyte-specific genes, including those that initiate folliculogenesis and those that encode the zona pellucida (ZP1, ZP2 and ZP3) required for fertilization and early embryonic survival. It is essential for oocytes to survive and form primordial follicles. The persistence of FIGLA in adult females suggests that it may regulate additional pathways that are essential for normal ovarian development. Figla binds to the E-box (5'-CANNTG-3') of the ZPs (ZP1, ZP2, ZP3) promoters.
Product Categories/Family for anti-FIGLA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
factor in the germline alpha
NCBI Official Synonym Full Names
folliculogenesis specific basic helix-loop-helix
NCBI Official Symbol
Figla
NCBI Official Synonym Symbols
bHLHc8; FIGalpha
NCBI Protein Information
factor in the germline alpha
UniProt Protein Name
Factor in the germline alpha
Protein Family
UniProt Gene Name
Figla
UniProt Synonym Gene Names
FIGalpha
UniProt Entry Name
FIGLA_MOUSE
Research Articles on FIGLA
Similar Products
Product Notes
The FIGLA figla (Catalog #AAA3203482) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Figla Antibody - C-terminal region reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Figla can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FIGLA figla for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSTRELLGNA TQPTSCASGL KKEEEGPWAY AGHSEPLYSY HQSTVPETRS. It is sometimes possible for the material contained within the vial of "Figla, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
