Rabbit anti-Human, Pig LYL1 Polyclonal Antibody | anti-LYL1 antibody

LYL1 antibody - C-terminal region

Cat. Num. AAA3200408

• Gene Names: LYL1; bHLHa18
• Reactivity: Human, Pig
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: LYL1; Polyclonal Antibody; LYL1 antibody - C-terminal region; anti-LYL1 antibody

• Host: Rabbit
• Reactivity: Human, Pig
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PDDGARRGSGRRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
• Sequence Length: 353

• Applicable Applications for anti-LYL1 antibody: Western Blot (WB)
• Homology: Human: 100%; Pig: 92%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LYL1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LYL1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Related Product Information for anti-LYL1 antibody

This is a rabbit polyclonal antibody against LYL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LYL1 contains 1 basic helix-loop-helix (bHLH) domain. A chromosomal aberration, translocation t (7;19)(q35;p13) with TCRB, involving LYL1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL).

Product Categories/Family for anti-LYL1 antibody

Polyclonal; Transcription Factor; Transcription Regulation; Transcription Factors; Cell Differentiation

NCBI and Uniprot Product Information

• NCBI GI #: 1196440
• NCBI GeneID: 4066
• NCBI Accession #: AAA88084
• NCBI GenBank Nucleotide #: NM_005583
• UniProt Accession #: P12980
• Molecular Weight: 38kDa
• NCBI Official Full Name: unknown protein, partial
• NCBI Official Synonym Full Names: LYL1 basic helix-loop-helix family member
• NCBI Official Symbol: LYL1
• NCBI Official Synonym Symbols: bHLHa18
• NCBI Protein Information: protein lyl-1
• UniProt Protein Name: Protein lyl-1
• Protein Family: Protein
• UniProt Gene Name: LYL1
• UniProt Synonym Gene Names: BHLHA18; bHLHa18
• UniProt Entry Name: LYL1_HUMAN

NCBI Description

This gene represents a basic helix-loop-helix transcription factor. The encoded protein may play roles in blood vessel maturation and hematopoeisis. A translocation between this locus and the T cell receptor beta locus (GeneID 6957) on chromosome 7 has been associated with acute lymphoblastic leukemia. [provided by RefSeq, Sep 2010]

Uniprot Description

LYL1: A chromosomal aberration involving LYL1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(7;19)(q35;p13) with TCRB.

Protein type: DNA-binding; Oncoprotein; Transcription factor

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleus

Molecular Function: protein dimerization activity; protein binding; DNA binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; B cell differentiation; blood vessel maturation