Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Placenta)

Rabbit LIMD1 Polyclonal Antibody | anti-LIMD1 antibody

LIMD1 antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
LIMD1; Polyclonal Antibody; LIMD1 antibody - N-terminal region; anti-LIMD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFAT
Sequence Length
503
Applicable Applications for anti-LIMD1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LIMD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Placenta)

Immunohistochemistry (IHC) (Human Placenta)

Immunohistochemistry (IHC)

(Human Placenta)

Immunohistochemistry (IHC) (Human Placenta)

Immunohistochemistry (IHC)

(Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0ug/ml using anti-LIMD1 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0ug/ml using anti-LIMD1 antibody )

Western Blot (WB)

(WB Suggested Anti-LIMD1 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysateLIMD1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-LIMD1 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysateLIMD1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-LIMD1 antibody
This is a rabbit polyclonal antibody against LIMD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LIMD1 may be involved in cell anchoring via focal adhesions and in the cell cycle, particularly during mitosis. LIMD1 functionally interacts with pRB and the loss of which promotes lung carcinogenesis. Some breast tumors also have altered expression of LIMD1 RNA. LIMD1 may represent a critical tumor suppressor gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
LIM domains containing 1, partial
NCBI Official Synonym Full Names
LIM domains containing 1
NCBI Official Symbol
LIMD1
NCBI Protein Information
LIM domain-containing protein 1
UniProt Protein Name
LIM domain-containing protein 1
UniProt Gene Name
LIMD1
UniProt Entry Name
LIMD1_HUMAN

Uniprot Description

LIMD1: Adapter or scaffold protein which participates in the assembly of numerous protein complexes and is involved in several cellular processes such as cell fate determination, cytoskeletal organization, repression of gene transcription, cell-cell adhesion, cell differentiation, proliferation and migration. Positively regulates microRNA (miRNA)-mediated gene silencing and is essential for P-body formation and integrity. Acts as a hypoxic regulator by bridging an association between the prolyl hydroxylases and VHL enabling efficient degradation of HIF1A. Acts as a transcriptional corepressor for SNAI1- and SNAI2/SLUG- dependent repression of E-cadherin transcription. Negatively regulates the Hippo signaling pathway and antagonizes phosphorylation of YAP1. Inhibits E2F-mediated transcription, and suppresses the expression of the majority of genes with E2F1- responsive elements. Regulates osteoblast development, function, differentiation and stress osteoclastogenesis. Enhances the ability of TRAF6 to activate adapter protein complex 1 (AP-1) and negatively regulates the canonical Wnt receptor signaling pathway in osteoblasts. May act as a tumor suppressor by inhibiting cell proliferation. Belongs to the zyxin/ajuba family.

Protein type: Tumor suppressor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: adherens junction; focal adhesion; cytoplasm; nucleus

Molecular Function: protein binding; zinc ion binding; transcription corepressor activity

Biological Process: cell migration; transcription, DNA-dependent; multicellular organismal development; cytoskeleton organization and biogenesis; signal transduction; miRNA-mediated gene silencing; osteoblast development; regulation of cell shape; regulation of transcription, DNA-dependent; response to hypoxia; cytoplasmic mRNA processing body assembly; negative regulation of osteoblast differentiation; negative regulation of transcription, DNA-dependent; phosphorylation

Research Articles on LIMD1

Similar Products

Product Notes

The LIMD1 limd1 (Catalog #AAA3209995) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LIMD1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LIMD1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the LIMD1 limd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDKYDDLGLE ASKFIEDLNM YEASKDGLFR VDKGAGNNPE FEETRRVFAT. It is sometimes possible for the material contained within the vial of "LIMD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.