Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0ug/ml using anti-GTPBP10 antibody )

Rabbit GTPBP10 Polyclonal Antibody | anti-GTPBP10 antibody

GTPBP10 antibody - middle region

Gene Names
GTPBP10; ObgH2; UG0751c10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GTPBP10; Polyclonal Antibody; GTPBP10 antibody - middle region; anti-GTPBP10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFL
Sequence Length
387
Applicable Applications for anti-GTPBP10 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GTPBP10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0ug/ml using anti-GTPBP10 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0ug/ml using anti-GTPBP10 antibody )

Western Blot (WB)

(WB Suggested Anti-GTPBP10 Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysateGTPBP10 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-GTPBP10 Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysateGTPBP10 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-GTPBP10 antibody
This is a rabbit polyclonal antibody against GTPBP10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
GTP-binding protein 10 isoform 2
NCBI Official Synonym Full Names
GTP binding protein 10
NCBI Official Symbol
GTPBP10
NCBI Official Synonym Symbols
ObgH2; UG0751c10
NCBI Protein Information
GTP-binding protein 10
UniProt Protein Name
GTP-binding protein 10
Protein Family
UniProt Gene Name
GTPBP10
UniProt Synonym Gene Names
OBGH2; ObgH2
UniProt Entry Name
GTPBA_HUMAN

NCBI Description

Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM, Mar 2008]

Uniprot Description

GTPBP10: May be involved in the ribosome maturation process. Complements an ObgE(CgtA) function in E.coli ribosome maturation. Plays a role of GTPase in vitro. When missing, disorganization of the nuceleolar architecture is observed. Belongs to the GTP1/OBG family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 7q21.13

Cellular Component: mitochondrion; nucleolus; chromosome

Molecular Function: GTPase activity; GTP binding; magnesium ion binding

Biological Process: metabolic process; ribosome biogenesis and assembly

Research Articles on GTPBP10

Similar Products

Product Notes

The GTPBP10 gtpbp10 (Catalog #AAA3206615) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GTPBP10 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GTPBP10 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GTPBP10 gtpbp10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IILLTKELEL YKEELQTKPA LLAVNKMDLP DAQDKFHELM SQLQNPKDFL. It is sometimes possible for the material contained within the vial of "GTPBP10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.