Immunohistochemistry (IHC)
(Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-KIF13B antibody )
Rabbit KIF13B Polyclonal Antibody | anti-KIF13B antibody
KIF13B antibody - N-terminal region
Gene Names
KIF13B; GAKIN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
KIF13B; Polyclonal Antibody; KIF13B antibody - N-terminal region; anti-KIF13B antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGKSYTMMGTADQPGLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNE
Sequence Length
1826
Applicable Applications for anti-KIF13B antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KIF13B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-KIF13B antibody )
Immunohistochemistry (IHC)
(Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-KIF13B antibody )
Immunohistochemistry (IHC)
(Rabbit Anti-KIF13B AntibodyParaffin Embedded Tissue: Human ProstateAntibody Concentration: 5 ug/ml)
Immunohistochemistry (IHC)
(Rabbit Anti-KIF13B AntibodyParaffin Embedded Tissue: Human ProstateAntibody Concentration: 5 ug/ml)
Western Blot (WB)
(WB Suggested Anti-KIF13B Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysateKIF13B is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-KIF13B Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysateKIF13B is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-KIF13B antibody
This is a rabbit polyclonal antibody against KIF13B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.
Target Description: KIF13B may be involved in reorganization of the cortical cytoskeleton. KIF13B may be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes.
Product Categories/Family for anti-KIF13B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
203kDa
NCBI Official Full Name
kinesin-like protein KIF13B
NCBI Official Synonym Full Names
kinesin family member 13B
NCBI Official Symbol
KIF13B
NCBI Official Synonym Symbols
GAKIN
NCBI Protein Information
kinesin-like protein KIF13B
UniProt Protein Name
Kinesin-like protein KIF13B
Protein Family
UniProt Gene Name
KIF13B
UniProt Synonym Gene Names
GAKIN; KIAA0639
UniProt Entry Name
KI13B_HUMAN
Uniprot Description
KIF13B: Involved in reorganization of the cortical cytoskeleton. Regulates axon formation by promoting the formation of extra axons. May be functionally important for the intracellular trafficking of MAGUKs and associated protein complexes. Belongs to the kinesin-like protein family.
Protein type: Motor; Microtubule-binding
Chromosomal Location of Human Ortholog: 8p12
Cellular Component: microtubule; kinesin complex; axon; cytoplasm
Molecular Function: protein binding; microtubule binding; microtubule motor activity; protein kinase binding; ATP binding
Biological Process: T cell activation; metabolic process; signal transduction; regulation of axonogenesis; microtubule-based movement; protein targeting
Research Articles on KIF13B
Similar Products
Product Notes
The KIF13B kif13b (Catalog #AAA3201794) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF13B antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIF13B can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the KIF13B kif13b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGKSYTMMGT ADQPGLIPRL CSGLFERTQK EENEEQSFKV EVSYMEIYNE. It is sometimes possible for the material contained within the vial of "KIF13B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
