Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Prostate)

Rabbit MYL6 Polyclonal Antibody | anti-MYL6 antibody

MYL6 antibody - middle region

Gene Names
MYL6; LC17; ESMLC; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM; LC17-GI; LC17-NM
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MYL6; Polyclonal Antibody; MYL6 antibody - middle region; anti-MYL6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMT
Sequence Length
151
Applicable Applications for anti-MYL6 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MYL6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Prostate)

Immunohistochemistry (IHC) (Human Prostate)

Immunohistochemistry (IHC)

(Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml using anti-MYL6 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Human Skeletal Muscle lysate tissue at an antibody concentration of 5.0ug/ml using anti-MYL6 antibody )

Western Blot (WB)

(WB Suggested Anti-MYL6 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysateMYL6 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-MYL6 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysateMYL6 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-MYL6 antibody
This is a rabbit polyclonal antibody against MYL6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MYL6 contains 3 EF-hand domains. It is the regulatory light chain of myosin. MYL6 does not bind calcium. Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
myosin light polypeptide 6 isoform 2
NCBI Official Synonym Full Names
myosin light chain 6
NCBI Official Symbol
MYL6
NCBI Official Synonym Symbols
LC17; ESMLC; LC17A; LC17B; MLC-3; MLC1SM; MLC3NM; MLC3SM; LC17-GI; LC17-NM
NCBI Protein Information
myosin light polypeptide 6
UniProt Protein Name
Myosin light polypeptide 6
Protein Family
UniProt Gene Name
MYL6
UniProt Synonym Gene Names
LC17; MLC-3
UniProt Entry Name
MYL6_HUMAN

NCBI Description

Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Genomic sequences representing several pseudogenes have been described and two transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

MYL6: Regulatory light chain of myosin. Does not bind calcium. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Motor

Chromosomal Location of Human Ortholog: 12q13.2

Cellular Component: membrane; unconventional myosin complex; myosin complex; cytosol; vesicle

Molecular Function: protein binding; structural constituent of muscle; motor activity; calcium ion binding; actin-dependent ATPase activity

Biological Process: axon guidance; skeletal muscle development; muscle contraction; metabolic process; ephrin receptor signaling pathway; muscle filament sliding

Similar Products

Product Notes

The MYL6 myl6 (Catalog #AAA3213516) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYL6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MYL6 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the MYL6 myl6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PMLQTVAKNK DQGTYEDYVE GLRVFDKEGN GTVMGAEIRH VLVTLGEKMT. It is sometimes possible for the material contained within the vial of "MYL6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.