Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Spleen)

Rabbit MKNK2 Polyclonal Antibody | anti-MKNK2 antibody

MKNK2 antibody - N-terminal region

Gene Names
MKNK2; MNK2; GPRK7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MKNK2; Polyclonal Antibody; MKNK2 antibody - N-terminal region; anti-MKNK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGRATDSFSGRFEDVYQL
Sequence Length
465
Applicable Applications for anti-MKNK2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 77%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MKNK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Spleen)

Immunohistochemistry (IHC) (Human Spleen)

Immunohistochemistry (IHC)

(Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0ug/ml using anti-MKNK2 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Human Placenta lysate tissue at an antibody concentration of 5.0ug/ml using anti-MKNK2 antibody )

Western Blot (WB)

(WB Suggested Anti-MKNK2 Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysateMKNK2 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-MKNK2 Antibody Titration: 1 ug/mlPositive Control: 721_B cell lysateMKNK2 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-MKNK2 antibody
This is a rabbit polyclonal antibody against MKNK2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MKNK2 may play a role in the response to environmental stress and cytokines. It appears to regulate transcription by phosphorylating EIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
MAP kinase-interacting serine/threonine-protein kinase 2 isoform 1
NCBI Official Synonym Full Names
MAP kinase interacting serine/threonine kinase 2
NCBI Official Symbol
MKNK2
NCBI Official Synonym Symbols
MNK2; GPRK7
NCBI Protein Information
MAP kinase-interacting serine/threonine-protein kinase 2
UniProt Protein Name
MAP kinase-interacting serine/threonine-protein kinase 2
UniProt Gene Name
MKNK2
UniProt Synonym Gene Names
GPRK7; MNK2; MAPK signal-integrating kinase 2; Mnk2
UniProt Entry Name
MKNK2_HUMAN

NCBI Description

This gene encodes a member of the calcium/calmodulin-dependent protein kinases (CAMK) Ser/Thr protein kinase family, which belongs to the protein kinase superfamily. This protein contains conserved DLG (asp-leu-gly) and ENIL (glu-asn-ile-leu) motifs, and an N-terminal polybasic region which binds importin A and the translation factor scaffold protein eukaryotic initiation factor 4G (eIF4G). This protein is one of the downstream kinases activated by mitogen-activated protein (MAP) kinases. It phosphorylates the eukaryotic initiation factor 4E (eIF4E), thus playing important roles in the initiation of mRNA translation, oncogenic transformation and malignant cell proliferation. In addition to eIF4E, this protein also interacts with von Hippel-Lindau tumor suppressor (VHL), ring-box 1 (Rbx1) and Cullin2 (Cul2), which are all components of the CBC(VHL) ubiquitin ligase E3 complex. Multiple alternatively spliced transcript variants have been found, but the full-length nature and biological activity of only two variants are determined. These two variants encode distinct isoforms which differ in activity and regulation, and in subcellular localization. [provided by RefSeq, Aug 2011]

Uniprot Description

Mnk2: a ubiquituous CAM kinase of the MAPKKAPK family. Regulates translation by phosphorylating S209 of eIF4E, thus increasing the affinity of this protein for the 7-methylguanosine-containing mRNA cap. The phosphorylation of eIF4E S209 by the MNK1/2 kinases is required for eIF4E's oncogenic action. Phosphorylates Spry2 on S112 and S121, leading to the ubiquitination and degradation of Spry2. Five splice-variant isoforms have been described.

Protein type: Translation; EC 2.7.11.1; Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; CAMK group; MAPKAPK family; MNK subfamily

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: nucleoplasm; PML body; cytoplasm; nucleolus; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; metal ion binding; ATP binding

Biological Process: regulation of translation; cell surface receptor linked signal transduction; hemopoiesis; protein amino acid phosphorylation

Research Articles on MKNK2

Similar Products

Product Notes

The MKNK2 mknk2 (Catalog #AAA3212175) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MKNK2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MKNK2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the MKNK2 mknk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDFGLQCSAR PDMPASQPID IPDAKKRGKK KKRGRATDSF SGRFEDVYQL. It is sometimes possible for the material contained within the vial of "MKNK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.