Immunohistochemistry (IHC)
(Human Prostate)
Rabbit EPB41L2 Polyclonal Antibody | anti-EPB41L2 antibody
EPB41L2 antibody - middle region
Gene Names
EPB41L2; 4.1G; 4.1-G
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
EPB41L2; Polyclonal Antibody; EPB41L2 antibody - middle region; anti-EPB41L2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST
Sequence Length
603
Applicable Applications for anti-EPB41L2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EPB41L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Prostate)
Immunohistochemistry (IHC)
(Human Prostate)
Western Blot (WB)
(WB Suggested Anti-EPB41L2 Antibody Titration: 1 ug/mlPositive Control: MCF-7 whole cell lysates)
Western Blot (WB)
(WB Suggested Anti-EPB41L2 Antibody Titration: 1 ug/mlPositive Control: MCF-7 whole cell lysates)
Related Product Information for anti-EPB41L2 antibody
This is a rabbit polyclonal antibody against EPB41L2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: EPB41L2 contains 1 FERM domain. The exact function of EPB41L2 remains unknown.
Target Description: EPB41L2 contains 1 FERM domain. The exact function of EPB41L2 remains unknown.
Product Categories/Family for anti-EPB41L2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
erythrocyte membrane protein band 4.1-like 2, isoform CRA_e
NCBI Official Synonym Full Names
erythrocyte membrane protein band 4.1 like 2
NCBI Official Symbol
EPB41L2
NCBI Official Synonym Symbols
4.1G; 4.1-G
NCBI Protein Information
band 4.1-like protein 2
UniProt Protein Name
Band 4.1-like protein 2
Protein Family
UniProt Gene Name
EPB41L2
UniProt Synonym Gene Names
4.1G
UniProt Entry Name
E41L2_HUMAN
Uniprot Description
EPB41L2: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Cytoskeletal
Chromosomal Location of Human Ortholog: 6q23
Cellular Component: spectrin; nucleoplasm; signalosome; focal adhesion; extrinsic to membrane; plasma membrane; nucleus; cell junction
Molecular Function: structural molecule activity; actin binding; PH domain binding
Biological Process: cortical actin cytoskeleton organization and biogenesis
Research Articles on EPB41L2
Similar Products
Product Notes
The EPB41L2 epb41l2 (Catalog #AAA3211740) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EPB41L2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EPB41L2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the EPB41L2 epb41l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AKRLWKVCVE HHTFYRLVSP EQPPKAKFLT LGSKFRYSGR TQAQTRQAST. It is sometimes possible for the material contained within the vial of "EPB41L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
