Immunohistochemistry (IHC)
(Rabbit Anti-LGALS7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human SkinPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Rabbit LGALS7 Polyclonal Antibody | anti-LGALS7 antibody
LGALS7 Antibody
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry
Purity
Affinity Purified
Synonyms
LGALS7; Polyclonal Antibody; LGALS7 Antibody; Galectin-7; TUBG1; EZH2; SUZ12; HECW2; ESR1; COPS5; CDK2; TCF3; INSIG2; UBC; WIPI1; USP38; USP15; USP1; GAL7; LGALS7A; anti-LGALS7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP
Applicable Applications for anti-LGALS7 antibody
Immunohistochemistry (IHC)
Protein Size
136 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the following sequence SRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVP
Predicted Homology Based on Immunogen Sequence
Cow: 93%; Dog: 79%; Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-LGALS7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human SkinPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Immunohistochemistry (IHC)
(Rabbit Anti-LGALS7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human SkinPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Immunohistochemistry (IHC)
(Rabbit Anti-LGALS7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ThymusPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Immunohistochemistry (IHC)
(Rabbit Anti-LGALS7 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ThymusPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-LGALS7 antibody
Description of Target: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:653499) is found adjacent to, but on the opposite strand on chromosome 19.
NCBI and Uniprot Product Information
Uniprot Description
LGALS7B: Could be involved in cell-cell and/or cell-matrix interactions necessary for normal growth control. Pro-apoptotic protein that functions intracellularly upstream of JNK activation and cytochrome c release.
Protein type: Cell adhesion; Apoptosis
Chromosomal Location of Human Ortholog: 19q13.2
Cellular Component: extracellular space; cytoplasm; nucleus
Molecular Function: carbohydrate binding
Biological Process: heterophilic cell adhesion; apoptosis
Similar Products
Product Notes
The LGALS7 lgals7 (Catalog #AAA3249656) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LGALS7 Antibody reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LGALS7 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the LGALS7 lgals7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SRFHVNLLCG EEQGSDAALH FNPRLDTSEV VFNSKEQGSW GREERGPGVP. It is sometimes possible for the material contained within the vial of "LGALS7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
