Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-L3MBTL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that L3MBTL1 is expressed in HEK293T)

Rabbit L3MBTL Polyclonal Antibody | anti-L3MBTL1 antibody

L3MBTL antibody - N-terminal region

Gene Names
L3MBTL1; L3MBTL; ZC2HC3; H-L(3)MBT; dJ138B7.3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
L3MBTL; Polyclonal Antibody; L3MBTL antibody - N-terminal region; anti-L3MBTL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEGQPTASTPESEEWS
Sequence Length
772
Applicable Applications for anti-L3MBTL1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Rabbit: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human L3MBTL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-L3MBTL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that L3MBTL1 is expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-L3MBTL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 293T cell lysateThere is BioGPS gene expression data showing that L3MBTL1 is expressed in HEK293T)
Related Product Information for anti-L3MBTL1 antibody
This is a rabbit polyclonal antibody against L3MBTL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: L3MBTL is the homolog of a protein identified in Drosophila as a suppressor of malignant transformation of neuroblasts and ganglion-mother cells in the optic centers of the brain. L3MBTL is localized to condensed chromosomes in mitotic cells. Overexpression of this gene in a glioma cell line results in improper nuclear segregation and cytokinesis producing multinucleated cells.This gene encodes the homolog of a protein identified in Drosophila as a suppressor of malignant transformation of neuroblasts and ganglion-mother cells in the optic centers of the brain. This gene product is localized to condensed chromosomes in mitotic cells. Overexpression of this gene in a glioma cell line results in improper nuclear segregation and cytokinesis producing multinucleated cells. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
lethal(3)malignant brain tumor-like protein 1 isoform I
NCBI Official Synonym Full Names
L3MBTL histone methyl-lysine binding protein 1
NCBI Official Symbol
L3MBTL1
NCBI Official Synonym Symbols
L3MBTL; ZC2HC3; H-L(3)MBT; dJ138B7.3
NCBI Protein Information
lethal(3)malignant brain tumor-like protein 1
UniProt Protein Name
Lethal(3)malignant brain tumor-like protein 1
UniProt Gene Name
L3MBTL1
UniProt Synonym Gene Names
KIAA0681; L3MBT; L3MBTL; H-l(3)mbt; H-l(3)mbt protein; L(3)mbt-like
UniProt Entry Name
LMBL1_HUMAN

NCBI Description

This gene represents a polycomb group gene. The encoded protein functions to regulate gene activity, likely via chromatin modification. The encoded protein may also be necessary for mitosis. Alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Sep 2010]

Research Articles on L3MBTL1

Similar Products

Product Notes

The L3MBTL1 l3mbtl1 (Catalog #AAA3202824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The L3MBTL antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's L3MBTL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the L3MBTL1 l3mbtl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLKPMKKRKR REYQSPSEEE SEPEAMEKQE EGKDPEGQPT ASTPESEEWS. It is sometimes possible for the material contained within the vial of "L3MBTL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.