Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Recommended KLHL23 Antibody Titration: 0.2-1 ug/ml)

Rabbit KLHL23 Polyclonal Antibody | anti-KLHL23 antibody

KLHL23 antibody

Gene Names
KLHL23; DITHP
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
KLHL23; Polyclonal Antibody; KLHL23 antibody; Polyclonal KLHL23; Anti-KLHL23; MGC22679; FLJ37812; MGC2610; KLHL-23; Kelch-Like 23; KLHL 23; DITHP; anti-KLHL23 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHL23 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
558
Applicable Applications for anti-KLHL23 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
This protein mediates protein binding.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
KLHL23 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITECY
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Recommended KLHL23 Antibody Titration: 0.2-1 ug/ml)

Western Blot (WB) (Recommended KLHL23 Antibody Titration: 0.2-1 ug/ml)
Related Product Information for anti-KLHL23 antibody
Rabbit polyclonal KLHL23 antibody
Product Categories/Family for anti-KLHL23 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
64 kDa (MW of target protein)
NCBI Official Full Name
KLHL23 protein
NCBI Official Synonym Full Names
kelch-like family member 23
NCBI Official Symbol
KLHL23
NCBI Official Synonym Symbols
DITHP
NCBI Protein Information
kelch-like protein 23
UniProt Protein Name
Kelch-like protein 23
Protein Family
UniProt Gene Name
KLHL23
UniProt Entry Name
KLH23_HUMAN

Uniprot Description

KLHL23:

Chromosomal Location of Human Ortholog: 2q31.1

Molecular Function: protein binding

Similar Products

Product Notes

The KLHL23 klhl23 (Catalog #AAA5301312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLHL23 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KLHL23 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KLHL23 klhl23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLHL23, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.