Western Blot (WB)
(Recommended NMRAL1 Antibody Titration: 0.2-1 ug/ml)
Rabbit NMRAL1 Polyclonal Antibody | anti-NMRAL1 antibody
NMRAL1 antibody
Gene Names
NMRAL1; HSCARG; SDR48A1
Applications
Western Blot
Purity
Affinity purified
Synonyms
NMRAL1; Polyclonal Antibody; NMRAL1 antibody; Polyclonal NMRAL1; Anti-NMRAL1; NMRAL-1; Nmra-Like Family Domain Containing 1; NMRAL 1; FLJ25918; HSCARG; anti-NMRAL1 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
NMRAL1 antibody was raised against the middle region of NMRAL1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NMRAL1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
299
Applicable Applications for anti-NMRAL1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of this protein is binding, oxidoreductase activity and transcription repressor activity.
Cross-Reactivity
Human
Immunogen
NMRAL1 antibody was raised using the middle region of NMRAL1 corresponding to a region with amino acids TCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFPGARDLANMFRFYA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(Recommended NMRAL1 Antibody Titration: 0.2-1 ug/ml)
Western Blot (WB)
(Recommended NMRAL1 Antibody Titration: 0.2-1 ug/ml)
Related Product Information for anti-NMRAL1 antibody
Rabbit polyclonal NMRAL1 antibody raised against the middle region of NMRAL1
Product Categories/Family for anti-NMRAL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
33 kDa (MW of target protein)
NCBI Official Full Name
NMRAL1 protein
NCBI Official Synonym Full Names
NmrA-like family domain containing 1
NCBI Official Symbol
NMRAL1
NCBI Official Synonym Symbols
HSCARG; SDR48A1
NCBI Protein Information
nmrA-like family domain-containing protein 1
UniProt Protein Name
NmrA-like family domain-containing protein 1
Protein Family
UniProt Gene Name
NMRAL1
UniProt Synonym Gene Names
HSCARG
UniProt Entry Name
NMRL1_HUMAN
NCBI Description
This gene encodes an NADPH sensor protein that preferentially binds to NADPH. The encoded protein also negatively regulates the activity of NF-kappaB in a ubiquitylation-dependent manner. It plays a key role in cellular antiviral response by negatively regulating the interferon response factor 3-mediated expression of interferon beta. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2015]
Uniprot Description
NMRAL1: disulfide-linked (Probable). Belongs to the NmrA-type oxidoreductase family.
Chromosomal Location of Human Ortholog: 16p13.3
Cellular Component: perinuclear region of cytoplasm; cytoplasm; nucleus
Research Articles on NMRAL1
Similar Products
Product Notes
The NMRAL1 nmral1 (Catalog #AAA839529) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NMRAL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the NMRAL1 nmral1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NMRAL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
