Western Blot (WB)
(KLHL31 antibody (MBS839785) used at 0.5 ug/ml to detect target protein.)
Rabbit KLHL31 Polyclonal Antibody | anti-KLHL31 antibody
KLHL31 antibody
Gene Names
KLHL31; KLHL; BKLHD6; KBTBD1; bA345L23.2
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purified
Synonyms
KLHL31; Polyclonal Antibody; KLHL31 antibody; Polyclonal KLHL31; Anti-KLHL31; KLHL 31; bA345L23.2; KLHL; KLHL-31; BKLHD6; Kelch-Like 31; anti-KLHL31 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHL31 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
634
Applicable Applications for anti-KLHL31 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 0.5 ug/ml
IHC: 4-8 ug/ml
IHC: 4-8 ug/ml
Biological Significance
KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE)
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(KLHL31 antibody (MBS839785) used at 0.5 ug/ml to detect target protein.)
Western Blot (WB)
(KLHL31 antibody (MBS839785) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-KLHL31 antibody
Rabbit polyclonal KLHL31 antibody
Product Categories/Family for anti-KLHL31 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
70 kDa (MW of target protein)
NCBI Official Full Name
kelch-like protein 31
NCBI Official Synonym Full Names
kelch-like family member 31
NCBI Official Symbol
KLHL31
NCBI Official Synonym Symbols
KLHL; BKLHD6; KBTBD1; bA345L23.2
NCBI Protein Information
kelch-like protein 31
UniProt Protein Name
Kelch-like protein 31
Protein Family
UniProt Gene Name
KLHL31
UniProt Synonym Gene Names
BKLHD6; KBTBD1; KLHL
UniProt Entry Name
KLH31_HUMAN
Uniprot Description
KLHL31: Transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE).
Chromosomal Location of Human Ortholog: 6p12.1
Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent
Research Articles on KLHL31
Similar Products
Product Notes
The KLHL31 klhl31 (Catalog #AAA839785) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLHL31 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's KLHL31 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 0.5 ug/ml IHC: 4-8 ug/ml. Researchers should empirically determine the suitability of the KLHL31 klhl31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLHL31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
