Western Blot (WB)
(Recommended prd Antibody Titration: 0.2-1 ug/ml)
Rabbit PRD Polyclonal Antibody | anti-PRD antibody
PRD antibody
Applications
Western Blot
Purity
Affinity purified
Synonyms
PRD; Polyclonal Antibody; PRD antibody; Polyclonal PRD; Anti-PRD; pr; Prd; CG6716; Primary Retinal Dysplasia; Dmel_CG6716; anti-PRD antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
PRD antibody was raised against the middle region of PRD
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PRD antibody in PBS
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-PRD antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
Prd is a pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments.
Cross-Reactivity
Drosophila
Immunogen
PRD antibody was raised using the middle region of PRD corresponding to a region with amino acids MTVTAFAAAMHRPFFNGYSTMQDMNSGQGRVNQLGGVFINGRPLPNNIRL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(Recommended prd Antibody Titration: 0.2-1 ug/ml)
Western Blot (WB)
(Recommended prd Antibody Titration: 0.2-1 ug/ml)
Related Product Information for anti-PRD antibody
Rabbit polyclonal PRD antibody raised against the middle region of PRD
Product Categories/Family for anti-PRD antibody
Similar Products
Product Notes
The PRD (Catalog #AAA839833) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PRD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the PRD for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
