<
Immunohistochemistry (IHC)
(Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human uterus tissue labelling Giantin with at 5ug/ml.)
Rabbit GOLGB1 Polyclonal Antibody | anti-GOLGB1 antibody
GOLGB1 antibody - N-terminal region
Gene Names
GOLGB1; GCP; GCP372; GOLIM1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GOLGB1; Polyclonal Antibody; GOLGB1 antibody - N-terminal region; anti-GOLGB1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE
Sequence Length
3259
Applicable Applications for anti-GOLGB1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GOLGB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human uterus tissue labelling Giantin with at 5ug/ml.)
Immunohistochemistry (IHC)
(Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human uterus tissue labelling Giantin with at 5ug/ml.)
Western Blot (WB)
(Host: RabbitTarget Name: GOLGB1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GOLGB1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GOLGB1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GOLGB1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GOLGB1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GOLGB1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-GOLGB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateGOLGB1 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-GOLGB1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysateGOLGB1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-GOLGB1 antibody
This is a rabbit polyclonal antibody against GOLGB1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.
Target Description: GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.
Product Categories/Family for anti-GOLGB1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
376kDa
NCBI Official Full Name
golgin subfamily B member 1 isoform 2
NCBI Official Synonym Full Names
golgin B1
NCBI Official Symbol
GOLGB1
NCBI Official Synonym Symbols
GCP; GCP372; GOLIM1
NCBI Protein Information
golgin subfamily B member 1
UniProt Protein Name
Golgin subfamily B member 1
Protein Family
UniProt Gene Name
GOLGB1
UniProt Synonym Gene Names
GCP372
Uniprot Description
May participate in forming intercisternal cross-bridges of the Golgi complex.
Research Articles on GOLGB1
Similar Products
Product Notes
The GOLGB1 golgb1 (Catalog #AAA3208222) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GOLGB1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GOLGB1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GOLGB1 golgb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NKYIEEMKAQ GGTVLPTEPQ SEEQLSKHDK SSTEEEMEIE KIKHKLQEKE. It is sometimes possible for the material contained within the vial of "GOLGB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
