Western Blot (WB)
(WB Suggested Anti-KCNRG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Rabbit KCNRG Polyclonal Antibody | anti-KCNRG antibody
KCNRG antibody - middle region
Gene Names
KCNRG; DLTET
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNRG; Polyclonal Antibody; KCNRG antibody - middle region; anti-KCNRG antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DTLLKEGFHLVSTRTVSSEDKTECYSFERIKSPEVLITNETPKPETIIIP
Sequence Length
272
Applicable Applications for anti-KCNRG antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCNRG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-KCNRG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Western Blot (WB)
(WB Suggested Anti-KCNRG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Related Product Information for anti-KCNRG antibody
This is a rabbit polyclonal antibody against KCNRG. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function. KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels (see MIM 176260) and inhibits their function (Ivanov et al., 2003 [PubMed 12650944]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1527 AY169388.1 1-1527
Target Description: KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function. KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels (see MIM 176260) and inhibits their function (Ivanov et al., 2003 [PubMed 12650944]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1527 AY169388.1 1-1527
Product Categories/Family for anti-KCNRG antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
potassium channel regulatory protein isoform 1
NCBI Official Synonym Full Names
potassium channel regulator
NCBI Official Symbol
KCNRG
NCBI Official Synonym Symbols
DLTET
NCBI Protein Information
potassium channel regulatory protein
UniProt Protein Name
Potassium channel regulatory protein
Protein Family
UniProt Gene Name
KCNRG
UniProt Synonym Gene Names
CLLD4; Potassium channel regulator
NCBI Description
This gene encodes a protein which regulates the activity of voltage-gated potassium channels. This gene is on chromosome 13 and overlaps the gene for tripartite motif containing 13 on the same strand. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
Uniprot Description
KCNRG: Inhibits potassium fluxes in cells. May regulate Kv1 family channel proteins by retaining a fraction of channels in endomembranes. 3 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 13q14.2
Cellular Component: endoplasmic reticulum
Molecular Function: identical protein binding; protein binding
Biological Process: protein homooligomerization
Research Articles on KCNRG
Similar Products
Product Notes
The KCNRG kcnrg (Catalog #AAA3202617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNRG antibody - middle region reacts with Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's KCNRG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNRG kcnrg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DTLLKEGFHL VSTRTVSSED KTECYSFERI KSPEVLITNE TPKPETIIIP. It is sometimes possible for the material contained within the vial of "KCNRG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
