Western Blot (WB)
(WB Suggested Anti-FITM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Rabbit FITM1 Polyclonal Antibody | anti-FITM1 antibody
FITM1 antibody - middle region
Gene Names
FITM1; FIT1
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FITM1; Polyclonal Antibody; FITM1 antibody - middle region; anti-FITM1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKH
Sequence Length
292
Applicable Applications for anti-FITM1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LOC161247
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FITM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-FITM1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Related Product Information for anti-FITM1 antibody
This is a rabbit polyclonal antibody against LOC161247. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The specific function of this protein remains unknown.FIT1 belongs to an evolutionarily conserved family of proteins involved in fat storage (Kadereit et al., 2008 [PubMed 18160536]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 BX347190.2 448-541 c 95-825 BI114004.1 1-731 826-928 BQ574746.1 1-103 c
Target Description: The specific function of this protein remains unknown.FIT1 belongs to an evolutionarily conserved family of proteins involved in fat storage (Kadereit et al., 2008 [PubMed 18160536]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 BX347190.2 448-541 c 95-825 BI114004.1 1-731 826-928 BQ574746.1 1-103 c
Product Categories/Family for anti-FITM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
fat storage-inducing transmembrane protein 1
NCBI Official Synonym Full Names
fat storage inducing transmembrane protein 1
NCBI Official Symbol
FITM1
NCBI Official Synonym Symbols
FIT1
NCBI Protein Information
fat storage-inducing transmembrane protein 1
UniProt Protein Name
Fat storage-inducing transmembrane protein 1
Protein Family
UniProt Gene Name
FITM1
UniProt Synonym Gene Names
FIT1
UniProt Entry Name
FITM1_HUMAN
NCBI Description
FIT1 belongs to an evolutionarily conserved family of proteins involved in fat storage (Kadereit et al., 2008 [PubMed 18160536]).[supplied by OMIM, May 2008]
Uniprot Description
FITM1: Plays an important role in lipid droplet accumulation. Belongs to the FIT family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 14q12
Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane
Biological Process: sequestering of lipid; phospholipid biosynthetic process
Similar Products
Product Notes
The FITM1 fitm1 (Catalog #AAA3211338) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FITM1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FITM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FITM1 fitm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YFHQYTHKVV GAAVGTFAWY LTYGSWYHQP WSPGSPGHGL FPRPHSSRKH. It is sometimes possible for the material contained within the vial of "FITM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
